SIP APP US14 >A2@0Ocaller made w/ NDEBUG or w/o MALLOC_DEBUGB@<<<<<<<<<<<<<<<<<~<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<=o=====f===========N==============================x===K K KKK// R#QQRQR#R8RTRTRsRTRi;B?B? ;e6e6;;e6;$HZ%~m@)AWSaaSWA 0(8$4 ,<"2 *:&6.>!1 )9%5 -=#3 +;'7/?            222~~~~H$.:Kz^JvUgE110 `@ ` `<<<<<<<<<<<<<<<<<<<<<< aq(|$"$*@-V/(!/8hk5G8=;4G+2IO?i/b4IEQUGeSI5JORY>FEV_KZb]YXLeVfbg7]joc]neJg(Jij_boY d;rvDfVWpju^unUxz4rhoz_xOz~B||Vi8yxlvyJ|{{{Mcz}s`q9ih{cxtyv#x}ZxuKqr| _d$w%swrZvkXymw{qop:zna`VYl^`B[ YcTad2zb8FN7cH _ q i buiPVt   EemmC(==p<H  ^ 9p"N\rz 8g   1 J [ t t !!D!L!U!!!"0"9"_"|"####$H$S$$$$$$%%W%m%%%&G&_&v&v&'7''(3()))")f)s)+ +>+\+k,3,C./D//0 010223 4577vGr LQ#FF<T%iww N8@Pw  : J c l !!!"0""# #*#4#%y%&&v&''(M()f)f),-9%;MHA `ޭޭ?cAl\'BDDFI%KNQUUY ]affkqxxDDI%NUU]ffqI%UUffUU   2@Pe>{ < q@'W1>Zv e! !#S!)0r2!.,-+|,/.D,C:>??7@=><=9<1*E(,-,/.Y,C-`46VrRD$y0\x^|2}dL uQZtlB!@       %' @f=p####(1-28?GxP1 ` c ӌ ӌ ӌ ӌ { ӌ Ӌ Ӌ Ӌ f i ӌ Ӆ ӈB@B@B@B@ B@000000|0t0l0d 0\0T Y c m w     & , 2 8 > D J P V \00000 0@00 H @(w@ 9 9 9 9 9 , 9 9 9 9 9 9 ) 9 9 9 9 9       # & 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 / 2 5 8$$,-.>? c ` f i l  X [ a ^ U    5 A  d [                                                    G G 6 G G G G G G G G G G G G G G G G G G G G G G G G G G G G z G G G G G G G G G G G G G G G G G G G G G G G G G G G 6 e J M M x < ) )  t q N |  ? G ?  R a a a a a a a a a a a a a 2 ' a a a a a a  P ,  a a a a i a a a a a a a a a a a a a a a a a a a a a a a a a a a a a a \ Y h \ h ~  7 7                   &     Y       ; ? C G K O        f * Z 6 M          1111 1 111    w  w ? ? w ?111 1119H0P@9@W.@9@W.@9@W.@9@`@p@P @D8@@0@P@Q@n@A@@@B@C@D@DA@8@@0@P@Q@n<0<0<0<0<0 @@0 0T0T0P@X98@@0118@@0x1l1d1\1T1L1D1<141,1$1 11401|@F@E ?0 @@0 ?01~ @@0,111@0d @@0,19 @@0,19 @@0,111@0 @@0,19 @@0,1,9 @@0,1D9 @@0,1\9 @@0,1p9 @@0,19 @@0,1 @@0,1 @@0,1 @@0,1~ @@0,19 @@0,1$0 ?0 0 ?019 @@0,@019H@0 @@0,8@@0x@P@R@S@U+@V@o@~11ܐ1ؐ140111119 @@0,$0x8@@0@P @D @@0 0 ?0 @0@ ?0,1 @@0T1 @@0h@0 @@0,9H@ 0 @@0,@0`0 @@0,1 @@0h$0 @@0,1 @@0h1 @@0,@0< @@0,@0d @@0,1 @@0h$0x19 @@0,@Q'@U;@^@_@n8@@0x@P @D1$$01,$014$?01( @@0'X~ @@0,1 1 @0>` @@0'X9 @@0,@Q"@0;d@Q"9P0>1 @@0h@0>1 1 1  @@0h@0>1 $ @@0h$0P0? P0>P0>P0)H @@0'@0?(@0.`?h0?L, @@0(@0?``@@0?`t`?0?xt1P0?1 (1@0? @@0'X@0? @@0,1 018@@0@Q"@T)@W@]:@^<@_@@m@}@~@0? @@0'X$0@ @@0,1 8 @@0'X~ @@0,1 @ @@0'X~ @@0,1 P @@0'X~ @@0,1 ` @@0'X~ @@0,1 h @@0'X~`? 0. @@0,1 d1 1 t1 @@0'X@0A @@0,1 @@0h$01 @@0h$01 P0A`P0A|P0A @@0'@0A1 @@0'X$0@`?0A @@0,P0@P0@P0@P0@\P07P0@8P0?P0>tP0> > > > ?N > = ?N >: > = >m ?N ?N ?N ?N ?N ?N ?N ?N ?N >z ? ?8 > B( BA B Bp BA B B B B B B BA B B B B B B B B B B B B B( C C C C C C C C C K KW KW KW K K L! L! K K K K L! K K K L! K K K K K K M< MB M M* L M M M6 M MB M0 M$ M M R/ R/ R R R/ R R R R R R R R R R R R R R R R R R R R Sd S Su Su SB SY S Su Su Su Su Su Su Su Su Su Su Sd S S T S S T T Xw Xw Y Y X Y Y Y Y Y Y Y Y Y Y- Y Y Y Y YA Y Y Y Y YP Z Z [ [ [ [ Z [ [ [ [ [ [ [ Z [ [ [ [ [ \F \F ] \ \ ]7 \ ]7 ]7 ]7 ]7 \ ]7 ]7 ] ]7 ]7 ]7 ]7 ]. \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ \ ]S ]S ]I ]S ]I ]I ]S ]I ]I ]S ]I ]I ]I ]I ]I ]I ]S ]I ]I ]I ]I ]I ]S ]S1T1L141,11111111111|1p1d1P1@1 1 1 1 1 1 1111t1X141$1111111111x1h1L1<1411@ b0 b5 b; bb bO c= c= c= c= c= c= b b c= c= bp c= c= c= c= bR b[ b$ b c= b b' c= c= bA c= bH bi c= c= a a b b by b b b b b c= c;Zx0Nm<[y1On i: i i iH i@ i iU iX i i[ i ic im im iw i i i i l l k l, k l+ l+ l+ l+ l+ l+ l+ l+ l+ l+ l+ l+ l+ l+ l+ l+ l+ l,ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=gE#ͫ2TvjxǷV$ p|G*0FFi؋DI!\׾k"qyC%b@@&^ZQǪ/]DSء!7 EZgoٍ*L9Bqma"8 DKϩK`p(~'09ۙ|ĬVe)"DC*#9e[YÏ ̒}]o~O,CNS~:5*һӑ sg s s s s` sv uS u uV u uY u u\ u_ ub un u uq u ut uw uz u} v4 vB vB v1 vB v4 vo vx vx v v vo v v v v v y+ x y! x y y y x x y+ y+ x x y+ y+ y+ x | | | | | | | | | | | |$ |< | | } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } } }r }G }G }G }G }G }G }G }G }G }G ~       ~      ~ ~ ~ ~ ~ ~ ~ ~ ~ ~        ~ ~ ~ ~                 x m z        " & * . 2 6 : O S W o o o o o o [ o _ c g o o o o o k    d  , X,,X,X,PU2d4Pdd,F(U2224P41$ 1$1#1#1#1#1#1#1#1#1%1%1%1%1%1%1%1%1% 1% 1%t 1%h 1%` 1%X1%P1%H"1%<%1%4#1%($1%&1% '1%(1$)1$/1$&1$>1$?1$@1$A1$B1$C1$xD1$lE1$`F1$T$1$D,1$4-1$$.1$    $ ( , 0 4 8 < @ D H L P T X \ ` d h l p   M 0123456789 * # A B CDEF G%H$IJKL10x10p10h10`10X10P10H10@10810010(10 1010 10   @~|U P ! $ ' *   S y |    B E P ! $ ' *   S y |    B E  g | = d t & < / N ` = 6 E W Z  / N ` = 6 E W Z   2  , v (  , v   , v   , v  ~      $   Z K 0k #(I-328?GPaZ0e1qd123A456B789C*0#DFRMMLP m w p p s s s sF g r x " x x x x x x x x x x x " " " x  e } q t t z w $ a d d g p yqR3 ƨ Ư ƶ ƽ ǃ z ǀ t z ( 3 N ȧ >   H K6B?0/ 25.'!.46:>:9    7*. 7*.5555555.435&0 4.;< 6"?#/$ .". %46 C.= C.:;-%-%1-%1,%,%1,%1<  555@55555555-%-%-1%-1%-%-1%-1%-%-%-1%-1%-%-1%-1%;%6B?0/25.'!.46:>::-.%-.%-.%,-*.,-*.,-*.555<65.434&04-.-.-.-.-*.7-*.7-*.7-.-.-.-.-*.7-*.7-*.7.;.56"?#/$.". %46.=%.9%6%1%1,1%*,1%*5559.55555555%1%1 ʐ ʴ ʖ ʖ ʜ ʨ ʢ ʮ ʖ ʺ ʺ ʺ ʮ ʺ ʺ ʺ ʺ ʺ ʺ ʢX E * &  ̤ ͖ ̓ 3 = ̠ (   ̻ n w - K ̒ ͩ o o o a { ˆ 1 5 9 3 P f o o ̷ e ̿ @ I \   o l , ̳ ̯ J M + 3 9 _ x { ~ ́ ̄ ̇ o o o o o o o o o o o o o o o o o o o o       ! % )  @@@@@@@@@@@@                        @ @ @ @ @ @@ @ @ @ @@  @ L O R U ` ϋ  ϓ ϧ Ϙ ϝ ϧ s ϧ    е Ц е Ф Љ Љ Ќ Б Б І Ц Ѿ Ѿ    5 V V L  7 N /  & ַ ַ ַ ַ ַ ַ ַ ַ ַ ֖ ֢ ֨ ַ ַ ַ ַ ַ ֐ ַ ֜ ֮ ִ ַ ַ ַ ֐ כ כ כ כ כ כ כ כ כ ו ו ו כ כ כ כ כ ׉ כ ׉ ׉ ׉ כ כ כ ׉ ٘ 9 9 9 9 ٘ ' 2 2 2 2 * $ * 2 2 2 2 ' P 3 P P $0<H 00004 P m { D : A ! !  * '    $"" "! B""#<C""8:12"3"4"5"=7"78"""""""""A H;BB"CB"DC"XEBq"rys@zt"|"}Av9_ "),*"+""" " BB'  '>YyȀ*c*vƃwք:v{'ZJbݐi6ܔtYC0")8Lc~ 6ḛ@L3ھ2Hé sFʲ!͒yg\XYam}8Ut'Jn$H k :Un  "$#%(&(')+,./02n35N68%9: 3 D> D> K> `> D> 3 D> D> 3 D> D> K> D> 3 D>: 338ff"33ww r u T W Z ] ` c f i l o x { ~ x { ~   (3@QfC- V  =(2[?eOdy~}  A A \ \ \ 56ckFFFFFF 56ck888TT8TaaTaa888TT8TaaTaa^ll^^x (R ^<  "$&(*,.02468:<>@BDEGIKMQSTUVWY[  !$'*-0369<?BEHKNQTWZ]`bfhlpw                                00000000000000000000000000000000>} `                         `     "EmC1_&  T C%\t__ ` ` ` ` ` `cSc0F0~0M0[0~0~0x0TQ'Q QQQw@EEEEFF F EEE1G1G1G1F1F1F1F1F1F1F1F1F|1Fl1F\1FL1FD1F41F 1F1F1E1E1E1E1E1E1E1Et1Ed1EX1ED1E01E1E 1D1D1D1D1D1D1D1D1D|}x@B@1-1O\1OT1OL1OD1O<1O01O\1O\1Ot1Oh1O`1O\1O\1OT1OD1P(1P1O1O1O1O1O1OL1O1O|1O\1P1P1P1PP1P41O\1Q,1Q 1Q1Q1P1O\1QT1QL1QH1Q@1Q81O\1Q\1Q1Q1Q1Q|1Qd1O\1R01R 1R1R1Q1O\1R`1RX1RP1RH1R@1O\1Rl1R1R|1O\1R1R1O\1S|1Sl1S\1SL1S<1S01S(1S1S1S1S1R1R1R1O\1U1Up1UD1U1T1T1T1Tp1TH1T$1T1S1S1S1O\1VD1V81V,1V 1V1V 1V1U1U1U1U1U1U1U1U1U1O\1Vh1Vd1V\1VT1VP1VL1O\1Vp1V1V1V1V1V1V1W1W(1W<1WX1Wt1W1W1W1W1X\1X,1X1O\1X1X1X1O\1X1RP1X1O\1X1X1Y1X1O\1X1Y1Yh1YD1O\1Z1Z1Z1Z1Z1Z1Zx1Zl1Z`1ZX1ZL1Z@1Z41Z(1Z 1Z1Z1Y1Y1Y1Y1Y1Y1O\1[1Z1Z1O\1X1[h1[81O\1X1RP1X1O\1[1[1[1O\1X1[h1[1[1O\1[81\41\ 1[1O\1c1c 1b1b1b1b1b1b1bd1bH1b,1b1a1a1a1a1a1a1a1al1aX1a@1a 1a1`1`1`1`1`1`p1`h1`T1`@1`,1`1`1_1_1_1_1_1_d1_H1_41_ 1_1_1^1^1^1^1^1^p1^d1^X1^<1^ 1^1]1]1]1]1]1]1]x1]\1]@1]$1]1\1\1\1\1\1\1\t1\X1O\1c1c`1c,1O\1c1c1c1O\1RP1X1d 1O\1[1[1d1O\1d 1X1d1d1c1d01d1O\1c1dh1d1dP1O\1d1O\1d1O\1RP1O\1X1e1d1d1O\1c1c1c1O\1RP1X1d 1O\1RP1X1e81d 1O\1RP1X1e81d 1O\1f1e1e1e1e1e1et1e\1eD1O\1f1f1f1f\1f<1f1O\1d 1X1f1g1d1d1c1d01d1O\1c1dh1d1dP1O\1Vh1h1h1h1h1h1h1h1h|1hp1hd1hX1hL1hD1h<1h,1h$1h1h1h1g1g1g1g1g1g1g1g1g1gt1gl1g`1gP1g@1g01g(1g 1g1g1O\1it1h1ip1il1ih1id1i`1iX1iP1iH1i@1i81i41i01i,1i(1i$1i 1i1i1i1i41i1i 1i1h1[1h1d1h1h1i41i1h1h1h1g 1h1h1O\1n1n1nT1n<1n$1n 1n<1m1m1n<1m1n 1m1mt1m`1m41m 1l1l1l1lx1lP1l 1l1k1k1k1k1kT1k81k1j1j1j1jt1jD1j1i1m 1l1l1i1ix1O\1q81q 1q1p1p1p1p1p1p1p1p1p1pl1p`1pP1p@1p41p(1p1p 1o1o1o1o1o1o1o1ot1oh1oX1oH1o81o(1o1o 1o1n1n1p41p(1p1n1n1O\1q81q 1q1p1p1O\1q1q 1q1q1q1qp1qd1qT1q@1p1p1p1pl1p`1pP1O\1q1r1rd1r,1r1q1q1q1O\1s1r1r1r1r1R1R1O\1sD1s<1s41s,1s$1U1U1O\1sL1sd1s|1s1s1s1s1O\1sD1O\1s1t 1s1O\1VD1t(1O\1i1i1O\1t41tT1O\1t\1O\1td1O\1O\1O\1th1tT1O\1t\1O\1td1O\1O\1O\1r1s,1O\1t1t1t1O\1RX1t1O\1h1t1O\1q1s$1O\1u1O\1r1u1u1O\1O\1O\1u,1u1u1u1u1u|1u`1u<1O\1vX1vL1v@1v41v(1v1v1O\1vd1O\1vd1v1v1v1O\1v1O\1v1O\1v1O\1v1O\1v1w$1w1O\1w41w$1w1O\1wP1w$1w1O\1w1w1w1w1w|1wx1wt1wp1O\1w1x1w1w1O\1x1x\1x,1O\1x1RP1X1O\1x1x1x1x1O\1x\1y1x1x1O\1y41y,1y$1O\1y<1h1i1O\1x,1yH1x1x1y@1O\1yd1y1y1y|1O\1zX1z41z1O\1zd1RP1X1O\1i(1[1[1O\1X1z41z1zl1O\1z1z1z1z1O\1{\1{T1{L1{81{ 1O\1{d1{1{1{|1O\1|`1|81|1O\1|l1RP1X1O\1i,1[1[1O\1X1|81|1|t1O\1|1}1|1|1O\1~1~1~1~1~1~1~x1~h1~X1~H1~81~(1~1~1}1}1}1}1}1}1}1}1}|1}l1}\1}L1}<1},1O\1~1~1O\11O\1X1O\1[1O\11<101O\1p1l1O\1p1t1O\111Q\11P1@111X1,11\111h1111,1 11111111|1x1O\1(1h1D1O\111O\1RP1X1O\1[1[1O\1X1111O\1111O\1@141,1 1O\1H1i1i1i,1O\11|1t1l1d1X1L1i41|1t1l1d1X1L111i,1i011111111111111111O\1p1l1O\1p1t1O\111d1H1(111O\111O\111O\11<1 1O\1p1d1O\111O\111O\1d1O\1RP1O\1[1O\1X1111O\1h1H1O\1RP11O\1X1h111O\1H11O\1t1h1\1P1@10111111111111x1d1P1<1,11111111O\111111O\10111O\1RP1X1L1O\1X1c1T1d1O\101d1dP1O\11111t1O\111111O\1h1y<1td1i1i1O\1 11O\101$111O\1<1111h1011111t1P1O\111l1X1(11111D11O\1,1 11111l1<111O\1RP1X1111|1t1h1\1T1P1d 1L1111O\1111X1$1111X1$111111l1L1,11111O\1V1111s<111O\11H1i 1i1i1i1i01O\1 1<1 1O\1d1X1O\11|1t111111O\1r111O\B@B@B@ttttty=yEyMyUy]yeymyyyyzPyzyy{y  %=[~ "&*.26:>BFJNRVg-  -( ?6 6,11Ͱ1ͨ1͠11111111Ҹ1Ұ1Ҩ1Ҡ1Ҙ1Ґ1҈1Ҁ.444:444:444444444444444444444::::444QWWWpppxɇxx[[[[[[[[We[p[e[[[[[ɇɇɇɇɀɀ`J-D[̵̇ʰJ̵ p˫3#˔c}̵̵̵̵̵̞̞<Sj'|͓ͪwͪΌΣϖ`θI/ϭϭXXXXXXXX!VXXXXXXXXXXXX$XXX[[[[[[[[[[[[[[[[[[[[['2=Goz[[[[[[[^/p[[[XXXXXXXXX0[[d[s[[XXXXXXXXXX[*5@L[WbXX[[[[XXXX[[ "R<[[ XXXX\[XX[[[;XT}XXXGbXX(I} #B@B@  M M $ ( C M ^ b f j n r vNz $*5mu}wy{!'-3ff?E ffff9ffffffKQ2*h2*X2*H2*82*(2*2*2)2)2)2)2)2)2*2*2*2*2*2*2*2*2*2*2*|2*x2)2+P2+D2+82+,2+ 2+2+2*2*2*2*2*2)2,l2,<2,2+2+2+|2+\2)2,2,2)2,2,2)2,2+ 2,2+++++++++++++++++++,, ,,,&,9,A,Q,Y,a,i,I,",.,q,u,y,,,,,,,,,,,,,-...H.w....<|<<<<<<<<<<<<<<<<<<<<<=== ====$=*=0=6=<=B=H=N=T=Z=`=f=l=r=x=~=====================>>>>>q>q>q>q>q>q>j>j>j>?@@C@??????@@@?AAA_A(A(A(A(A(A(BBBA_BBBBBBBBCVCVCVBCCCCCCCCCCCCDTDDDED9DDDDDDDDuDDDDDDDDDDDDDDDDDDMMMOOOOMMMMMMMMMMMNNN NNONN$N*N0N6OON<NBNHNNNTNZNnNtNzNOOOONNNNNNNNNNNNOOOOOOOONNNNONNOOONNNOOOOOOO OOOO"O(OOOOOOOOOOO.O4O:O@OFOLOROXO^OdOjOpOvO|OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOeelete|eeeeeeeeeeeeeeeeff fff$f,T@hhhhhhhhhhhhhhhhhhhhhhhhhjMjwnjjnnjk,k]kkkkll6lOllmm>mnmmnnnn-nSngviijrsbsbrrsJsVs&s>sbs2v4v8v<v@vDvHvLLK@LK@LK@;;OVLY B@LK@&%LK@nj2&%B@;;Bm 6PPPxxxP 0B@entz;r{$&%# 4@./0 2@3K(L(M(N 7 5( 6(@>((((?(@(A( :(@;(B8C8D0E0F0G0 H0@I0J0222222I2K2$2M2O2+2x02lQ2`S2X52P72H1===L=[s22\/2M2O2+e 222222pH2`J2T#2PE2D  m&x[}^1xZdiloJSt} . .rrrr.  LLQL^LK@B@B@LK@B@IOUgq[aB@B@e` ow׈|ׂ׈UTP٩0\0?^ai00\0ehk5jBd٩00t0|00 0\00-03B[ad!w٩00\04 -\0@0\0hknN٩0 0\0EeD"/٩0  0\00>>> >>*>O>z>=>}>}>>>J0  0\00 ?B?E?H?z?@;@i=<>P@>@H@l@v٩0 0\0|0Y2Y5Y8YMYeYYY9; ZYYYY&05000\0Z}ZZ[#\\w45\\>\U\\٩040\0    : V  P r  S V٬00\00 !9[F E0 222222222222 222222282(2 20\05555566@6n6666C6M6q6{00\0L0X!!##00000\00$!$$$'$_$%$%Z%??%%m%w%%۾00\0D,I,L,O,r,,,----0P0\02]2`2c2r23323Q33538ڠ00\0$444404Q4445B44000\00!!!!!"W""CbB"""""W0ۨ۳ۨ+ܾܾܿܿrz܀ܓܙܟܥܫހ %}%%  cScTTTyy  U Qwwrrorrrror11*-'&EEEEEZZYSVMPaa  ]#*->Z i f l |  o o   F F F F  ,         <    n n d g j n m ;>ATWDL}}}}}}}mbb&03bbAbb>PSVbbY\ HHQQADGPJB@?^Mxxx^^^Z!!!!!"""" " """#9""#9"$$$$$$$$$$$$$$$$$$$$$%$$$% %%7%5%2%7%?%K%%%%%%%%%%%%&;&?&?&O&[&[*++H+H+H+$+*+0+<+6+B&'''(@(a&''((V(w2X2H242$+l++,2+,,,,,,,,,,,,,,,,,,,,,-------------------... ...l......./////v///g/g////           0000011&1`1p11111                         22222222223,33,3,3#3M3M3F3I3L4c4d4g4j4m4p4s4v4444444455666666 6666)6/6(6/6:6:6:6:6:6:6:676j6j6`6c6f666667373737"7%70707(70707+7c7f7c7f7y7y7y7y7y7y7y7q88888i8i8i8i8i8i888i8988888999998+8>;>>>G>J>A>D>v>v>v>v>u>u>u>]>`>g>n>>>>>>>>>>@4@4@4@4@3@3@3?????????@@@@!@'@e@e@[@^@a@@@@@NN  ST3SST3SSS+#|[2-9]xxxxxxxxx|1[2-9]xxxxxxxxx|x.T)DIALPLANTIMER%ldTRANSPORT_TYPETCPINBANDDTMFNOLINE%dCALLERIDLINE%dPORTLINE%dAECOFFLINE%dAUTHUSERLINE%dAUTHPSWDUSER%dHOST%dPORT%dCCAPITESTY MAC %02x%02x%02x%02x%02x%02xHTTPWANNOHTTPLANTELNETWANTELNETLANVOIPDISCWANVOIPDISCLANsrc/common/netset.c%d.%d.%d.%d0.0.0.0DOMAINNAMESERVERREGISTERSERVERIPSERVERPORTSERVERIP%dSERVERPORT%dVLANTAG_CALLPRIORITYTAG_CALL%sON%sSS%sPACKYES%s, Forcing G723 packetization to %d Packetization = %d Using default packetization %d %s packetization = %d G723G729G726G711UG711AT38_ECC_TYPEREDUNDANCYFECT38_RATE_MANAGEMENTTRANSFERREDLOCALADV_CALLINGADV_CALLINGEXTLINE%dREGISTERREDNSUPPORT_ROUTERSUPPORT_PPPSUPPORT_PPTPT38FLAGT38NUMLINES%luSUPPORTEDCODECS%ldT.38G726-16G726-24G726-32G726-40G723G723LG729EG729AG711UG711AunknownOn HookOff HookRingingWaitingConnectedDisconnectHeldConnected T38 %s Reboot check-sync waiting... %s Rebooting by check-sync SIP Line %d - Fax Detected Event: %ssrc/common/call.cCALL_XFERREDCALL_XFERCALL_HELDCALL_HOLDCALL_CONNECTCALL_ALLERTCALL_OUTGOINGCALL_INCOMING%lx,%lx: ==>CallChangeState():: from %s to %s %lx,%lx: CallChangeState():: not allowed %s%dDND_LINEAUTOREDIAL_LINECALL_FWD_LINEBLOCK_CALLLINE%d_ACR,WAITINGWAITING_IDCIDCONFERENCEREDIAL_LASTTRANSFERDIST_RINGSDNDFORWARDBLOCK_LASTAUTO_REDIALBLOCK_CIDACRFWD_ONFWD_OFFFWD_CNDDND_ONDND_OFFTRANFERACCEPT_LASTAUTO_REDIAL_ONAUTO_REDIAL_OFFForward OFFUNCONDCONDCondition Forward ONForward ONCALL_FWD_LINE%dLINE%dCALL_REVERSE_POLARITYKEY_FWD_CONDITION*1KEY_FWD_ON*2KEY_FWD_OFF*3KEY_DND_ON*4KEY_DND_OFF*5KEY_TRANSFER*98KEY_LAST_REDIAL*69KEY_LAST_BLOCK*60KEY_LAST_ACEPT*80KEY_AUTO_REDIAL_ON*66KEY_AUTO_REDIAL_OFF*86KEY_BLOCK_CID*70KEY_ACR_ON*77KEY_ACR_OFF*87TIMER_AUTO_REDIALOFFHOOK_WARNING_TIMERDEAD_AIR_PERIODINFO_MIDCALL_SERVICEYESADV_CALLINGADV_CALLINGEXTDND_LINE%uONAUTOREDIAL_LINE%uCID_CNAM_UNKNOWNHALF_CALL_MODELCID_CNAM_ANONYMOUSszDialString=%s Invalid numberDial numberanonymous Incoming #%sCID: %s, %ssrc/common/endpoint.c%d: CALL_FWD_LINE%uftelephone-eventflash-hookSignal=%c Duration=%d Bellcore-drMessageWaitingyesno%s NOTIFY_CHECK_SYNCDISABLEDOVER_MAX_LOCAL_TIMERESETSIPCheck-sync: RESET.CONF_FILE_POLL_NOWCheck-sync: AC is disabled.Check-sync: AC proces is activated.Check-sync: AC fixed mode is not configured.Check-sync error: unknown NOTIFY_CHECK_SYNC = %sCheck-sync error: timeout after reset is too smallSIP_INVITE_NO_SDPYESSIP_TEL_URISIP_URI_USER_PARAMRING_NAME_%dSIP_SEND_183_RTPSIP_SEND_PRACKSIP_INVITE_TIMERSIP_SESSION_TIMERSIP_REGISTER_TIMERLINE%dNUMBERBLOCK_CALL%uLINE%d_ACRONCALL_FWD_LINE%uUNCONDCONDsrc/common/stack.cLINE%dPRIVACYSIPPRIVACY_FULLSIPPRIVACY_NAMESIPPRIVACY_URISIPPRIVACY_OFFFAX_CODECG711AG711UNONELINE%dFORCECODECG729G723G726Registering ...check-syncmessage-summaryDirect Call ModeStackPlaceCall():: startedStackPlaceCall()::StackInstanceCB():METERINGline:%d Call Reverse the Polaritysrc/common/stackcbk.cRegisteredRegistration FailedSIPSelected codec: %sDurationSignalsrc/common/state/OnHook.cDial numberDND ONDND OFFIncoming call rejectAttended Transfer completedAttended Transfer failedDND ONDND OFFsrc/common/state/OffHook.cLINE%d_ACRONACR ONACR OFFAUTOREDIAL ONAUTOREDIAL OFFDial Forward #Forward OFFDial #CALL_FWD_LINE%uUNCOND,%sForward ONCOND,%sCondition Forward ONTransferring...Dial ErrorCallingInvalid numberBGGR TEST: Call retrievedBGGR TEST: Off Hook: !HOLD, call#=1 BGGR TEST: Off Hook: call#!=1 Transfer abortedNo call to restoresrc/common/state/Ringing.cIn Call %sDisconnectedsrc/common/state/Waiting.cWaiting: Transferring...Waiting: Call tranfer: %s to %sWaiting: EVENT_ON_HOOKIn Call %sConference CallEVENT_CBK_DISCONNECTEDEVENT_CBK_REJECTTransfer failedDisconnectedHold disconnectedRinging (Xferred)In call (Xferred)No call to restoreConnect: Call tranfer: %s to %sConnect: EVENT_ON_HOOKIn ConferenceBGGR TEST: Call hold: Dial new#src/common/state/Connect.cBGGR TEST: Connect: AcceptBGGR TEST: Connect: RetrieveBGGR TEST: Connect: Call ConferenceDial transfer to #DisconnectedCall being heldCall being X-feredCall being retrievedsrc/common/state/ConnectT38.csrc/common/state/Disconnect.cAUTOREDIAL ONAUTOREDIAL OFFIncoming call rejectTransfer completedTransfer failedCall being retrievedFlash not allowedTransfer not allowedsrc/common/state/Held.cCall being retrievedDisconnectedHold disconnectedCall being X-feredsrc/common/state/AutoRedial.cDial numberIn Call %sIncoming call rejectUSER_AGENTv%d.%d.%c%c%c%c%c%cAC-211Telco Systems %s %s%sTimeZone offset is [%ld] Daylight saving is [%s] ENABLEDDISABLEDsrc/main/sipapi.cVLAN Tag set to %dPriority Tag set to %dTOS set to %dUser Agent set to %sSIP protocol starts/mqSipSip set local IP %sSip set local IP %ld.%ld.%ld.%ldSip set local IP %ld.%ld.%ld.%ld %sSip set local port %dSip set remote IPs - %sSip set remote port %dSip instance uses %s as defaultUDPTCPSip instance set domain name- %sSip instance forward: %s ONOFFSip instance destroyIDLEACTIVETERMINATINGTERMINATING_CALLTERMINATING_TRANSPORTTERMINATED???%s %sCallINITIALIZEDSTARTLINE%uOOBTELEVENTSYESOOB_RFC2833LINE%uTELEVENTPAYLOAD96LINE%uDROPVOICELINE%uABCDMODECONTINUOUSLINE%uPLAYDTMFOOB_SIP_INFOOOB TEST_InitOOBConfig: OOB_SIP_INFO %d line=%dLINE%uSQUELCHDTMFLINE%uPLAYINFODTMFsrc/call/sipmedia.c_QueryCap(): pMediaForced to CODEC: %d%s %sSIP_INSTANCEpSdpLclpSdpRmtSdp Media%s Stream=0x%lxsrc/main/sipinst.cSip instance constructSipInstConstruct() EndedSip instance destructSIP Instance startedSip instance start - local IP %ld.%ld.%ld.%ld %s**RX**: %s%sSyntax ErrorHeader IncompleteSDP IncompleteContent To ShortMethod Not AllowedCall/Transaction Does Not Existversion not supportmissing CSeq headermissing From headermissing To headerError in packet- %s BLOCK_CALL%uABNF_NOERRABNF_COMMANDABNF_HEADERABNF_HEADER_INCOMPLETEABNF_SDPABNF_SDP_INCOMPLETEABNF_CONTENT_TOOSHORTABNF_CONTENT_UNKNOWNABNF_MAXsrc/call/callsend.c**TX**: %sSipCallSendPkt(): SIPREQSipCallSendPkt():REFER, UPDATE, INFO, OPTIONS, ACK, INVITE, BYE, CANCEL, NOTIFY, SUBSCRIBE, PRACKREFER, UPDATE, INFO, OPTIONS, ACK, INVITE, BYE, CANCEL, NOTIFY, SUBSCRIBETESTSipSendReqMsgNotify():: %sto-tag=from-tag=Replaces%s;to-tag=%s;from-tag=%stimer,100rel,replacestimer,replaces100relanonymousSipSendErrRspMsg: %d, %s localhostAnonymousanonymous.invalid%lx-%lxprivacyREFEROPTIONSBYEACKCANCELUPDATEINVITEREGISTER%s:%ssip:%s@%ssip:%smd5-sessmd5%08lxauthauth-initsrc/misc/siputil.cCan't resolve host %s%s -> %s, Addr=%ld.%ld.%ld.%ldcan't get name, use IP: %sGetHostName() - hostname is %s%%%Xsrc/call/sipcall.cNew call constructedCall destructed_sip._tcp.%s_sip._udp.%stimersrc/abnf/rxabnf.capplication/sdptext/plainapplication/simple-message-summaryapplication/message-summaryapplication/dtmf-relaymessage/MeteringContent length is %ld SIP_DECODERWrong SDP content length %d. The correct one is %d,IP6IP4smhd.-MPALPCGSMH263H261G728G722PCMAG723G7211016PCMUtelephone-event a=t38UDPFECt38UDPRedundancya=T38FaxUdpEc:a=T38FaxMaxDatagram:a=T38FaxMaxBuffer:localTCFtransferredTCFa=T38FaxRateManagement:a=T38TranscodingJBIG:a=T38TranscodingMMR:a=T38FaxFillBitRemoval:a=T38MaxBitRate:a=T38FaxVersion:a=rtcp:a=sendrecva=recvonlya=sendonlya=fmtp:a=ptime:/a=rtpmap:tcpudpudptlRTP/AVPdataimagevideoaudio=iINc:bclear:base64:uri:promptkartpeuov660660460360055055045035025015004491489488487486485484483482481480422420415414413411410409408407406405404403402401400338030530330230130022022001183182181180100P-N-UAType;noyesscreencalledcallingpartytermusersubscriberid-typeoffurinamefull,privacyRPID-Privacy)('*~!_%?$+&#@transport=ipphoneuser=lrBYEACKINFOPRACKQUESTREFERNOTIFYUPDATECANCELINVITEMESSAGEOPTIONSREGISTERSUBSCRIBEmethod=ttl=maddr=][sip:tel:><Remote-Party-IDNMEQuestMin-SEuacuasrefresherxSession-ExpiresschemerefReferred-ByRefer-TotagRequested-Byactiveinactivetoken=version=status=AlsoRSeqRAckProxy-Requirecnonceauthauth-intqopMD5MD5-sessalgorithmtruefalsestaleopaquencnoncedomainresponseusernamerealmDigestBasicProxy-AuthenticateWWW-AuthenticateProxy-AuthorizationAuthorizationWarningbranchreceivedhiddenTCPUDPSIPViaUser-AgentTimestampUnsupportedSupportedServerdurationSatFriThuWedTueMonSunDecNovOctSepAugJulJunMayAprMarFebJanGMTRetry-AfterRequireRouteRecord-RouteMax-ForwardsTofFromExpiresEventDateCSeqContent-TypelContent-LengthexpiresproxyredirectactionqContactCall-IDAllowAccept-LanguageAccept-EncodingAcceptAlert-InfoterminatedpendingSubscription-Statefrom-tagto-tagearly-onlyReplacessrc/abnf/header.csrc/abnf/translate.csrc/misc/sipcopy.cTESTSipCallSendNotify():: %s%lx%lx-%x-%lx-%lx@%s%lx%lx-%x-%lx-%lx@%ld.%ld.%ld.%ldSIP_TERMINATINGSIP_SUBSCRIBEDSIP_SUBSCRIBINGSIP_SRV_FORWARDINGSIP_SRV_REGISTEREDSIP_BEING_XFEREDSIP_TRANSFEREDSIP_TRANSFERINGSIP_FORWARD_REMOVESIP_FORWARD_ADDSIP_FORWARD_QUERYSIP_UNREGISTERINGSIP_REGISTEREDSIP_REGISTERING_ERRSIP_REGISTERINGSIP_REGISTERSIP_REINVITINGSIP_DISCONNECTINGSIP_CONNECTEDSIP_PROCEEDINGSIP_INVITINGSIP_INCOMINGSIP_IDLESIP state change: %s ===> %sICMP:type = 3 code=%d Sa=%ld.%ld.%ld.%ld:%d, Da=%ld.%ld.%ld.%ld:%d src/call/calltask.c_SipReqPktReTx():PRACK timeoutSip call request timeout - Call ID %s type %x CSEQ %ld %lx-%lxsrc/call/subscribe.cInst SendUDP %ld bytes %s src/main/sipstack.cSIPsrc/trans/transport.csrc/trans/buffer.c%c%c%c%c%c%c%c%c%c%c%c%c New INVITE from %sNew INVITE (Transferred) from %sREGISTERED on server %ld.%ld.%ld.%ldAppCbkMediaQueryCap()src/call/process.cRepeat Requestretransmit requestRepeat ResponseMethod Not AllowedRequest/Response not supportedresend responsetimerreplaces100rel, ,Bad ExtensionSIP received OPTIONS - received packet %d in call state %s100relThe client does not want to be disturbed by YOU!src/call/eventRequests.canonymousTry againSIP received INFO - received packet %d in call state %sSIP received MESSAGE - received packet %d in call state %stelephone-eventBad Eventsrc/call/msgAccept.cSIP received 1xx - received packet %d in call state %ssrc/call/event1xx.cSIP received BYE - Channel %d received packet %d in call state %ssrc/call/eventBye.cSIP received ACK - received packet %d in call state %sSIP received 3xx - received packet %d in call state %sNo contact headersrc/call/event3xx.ctemporarily moved: contact %ssrc/call/msgXfer.c%s %d SIP received INVITE - received packet %d in call state %ssrc/call/eventInvite.c100relThe client does not want to be disturbed by YOU!anonymousTry again%lxUPDATESIP received 2xx - received packet %d in call state %ssrc/call/event2xx.cUPDATEfinally: expires=%d SIP received 5xx - received packet %d in call state %ssrc/call/event5xx.cSIP received 4xx - received packet %d in call state %ssrc/call/event4xx.csrc/call/msgReject.csrc/call/msgPlace.cSIP received CANCEL - received packet %d in call state %ssrc/call/eventCancel.csrc/call/msgChgStream.csrc/call/eventPrack.c%lx-%lxsrc/call/register.cSIP REGISTER : expire timer set to %ldDoes not exist anywhereDeclineBusy EverywhereSIP Version not supportedGateway TimeoutService UnavailableBad GatewayNot ImplementedInternal Server ErrorNot Acceptable HereRequest CancelledBusy HereAmbiguousAddress IncompleteToo Many HopsLoop DetectedCall Leg/Transaction Does Not ExistTemporarily not availableSession Interval Too SmallBad ExtensionUnsupported Media TypeRequest-URI Too LargeRequest Entity Too LargeLength RequiredGoneConflictRequest TimeoutProxy Authentication RequiredNot AccepetableMethod Not AllowedNot FoundForbiddenPayment RequiredUnauthorizedBad RequestAlternative ServiceUse ProxyMoved TemporarilyMoved PermanentlyMutliple ChoicesAcceptedOKSession ProgressQueuedCall Is Being ForwardedRingingTryingapplication/sdp en;q=0.8ipSipEncodePacket: SIPHDR_REPLACES TESToSubstateValue=%dapplication/dtmf-relayaudio/telephone-eventSipEncodePacket: %stext/plainflash-hooksrc/call/msgDetectFax.cSipMsgDetectFax: T38 SipMsgDetectFax: New T38 SipMsgDetectFax() pMediaAudSipMsgDetectFax() pMediaT38Rfc1123 date: year %d mon %d day %d %d:%d:%d, yday %dNtpLocaltime: year %d mon %d day %d %d:%d:%d, yday %dSIP received REFER - received packet %d in call state %ssrc/call/eventRefer.csrc/abnf/sdpabnf.c-0t38src/call/msgRing.csrc/call/msgForward.csrc/call/msgHangup.c:md5-sessauth-intsrc/md5.csrc/abnfapi.c%ld%lu%lxsrc/decoder.csrc/mh_handset.c%d: Off hook%d: %sOn hook%sD2#D1#A%s#D3#B00CB10CD%sCPOff hook %02d:%02d%s %02d/%02dPMAMmessage waiting indication is %s on line: %dONOFFSIP_MWI_STUTTER%d1COUNTRYUKUSABELGIUMGERMANYJAPANSWEDENFRANCEDENMARKITALYSLIC driver .../slicHandsetInitialize: SLIC driver FAILDIALPULSEYESSTAGGERED_RINGSFLASH_HOOK_TIMER_MAXFLASH_HOOK_TIMER_MINConfigflash-hook max. cound not be less then min. Setting defaut valuesAudio channel %d ...Audio channel %d FAIL440@-13#[ON(300),IDLE(3700)]5440@-13#ON(110),OFF(110),ON(110)440@-13#ON(110),OFF(110),ON(110),OFF(110),ON(110)440@-13#ON(110),OFF(110),ON(330),OFF(110),ON(110)1400@-6+2060@-6+2450@-6+2600@-6#[ON(100),OFF(100)]200350@-13+440@-13#[ON(100),OFF(100)]10ON(200),OFF(200),ON(200),OFF(200),ON(200),OFF(200),ON(200),IDLE(2000),RMETERINGline: %d Period=%ld(sec) Pulses=%ld Call time=%ld(sec)NO_EVENTON_HOOK_EVENTOFF_HOOK_EVENTOFF_HOOK_WITH_DIAL_EVENTDIAL_EVENTPULSE_DIAL_EVENTHOOK_DOWN_EVENTFLASH_HOOK_EVENTHIT_HOOK_EVENTMODEM_TONE_EVENTFAX_TONE_EVENTANSWER_TONE_EVENTKEY_DOWN_EVENTKEY_UP_EVENTLONG_DURATION_DTMF_EVENT DTMFT38_STARTT38_STOPOFFHOOK_IDLEONHOOK_IDLEONHOOK_RINGINGONHOOK_WAITING_FOR_FLASHONHOOK_SENDING_CIDONHOOK_SENDING_VMWIOFFHOOK_CWT_ONMAXRING_9RING_8RING_7RING_6RING_5RING_4RING_3RING_2RING_1RING_0CALLWAITING_4CALLWAITING_3CALLWAITING_2CALLWAITING_1CUSTOM_9CUSTOM_8CUSTOM_7OFFHOOK_WARNINGCUSTOM_5CUSTOM_4HOLDCALLWAITING_6CALLWAITING_5REORDERMSG_WAIT_INDICATOROFF_HOOK_WARNSTUTTER_DIALCONFIRMNETWORK_BUSYCALLWAITINGRINGBACKBUSYDIALTONEDTMF_DDTMF_CDTMF_BDTMF_ADTMF_POUNDDTMF_STARDTMF_9DTMF_8DTMF_7DTMF_6DTMF_5DTMF_4DTMF_3DTMF_2DTMF_1DTMF_0ONOFFIDLERConfiguring tone %s - %s src/common_handset.c Error in HandsetMapTone::UPD_TONE_CONFIGURE error=%ld Configuring ring pattern %s - %s !Error configuring tone! - error %d !Error configuring ring! - error %d G729ONg729.ovlG723ONg723.ovlG726ONg726.ovlYESOverlaying %s module Error dynamically overlaying %s library! AUDIO ERRORNODynamic overlaying of %s library successful MediaStreamSetCap(): Endedsrc/ms_setcap.c_MediaStreamSetAudCap(): Ended_MediaStreamSetT38Cap EndedPROTOCOL MEDIA AUDIOPROTOCOL MEDIA VIDEOPROTOCOL MEDIA DATA PROTOCOL MEDIA IMAGEPROTOCOL MEDIA LINE No errorGeneral error channel not initializedout of memorytone configuration errorCaller ID already active in the channel for which current registration of Caller ID is being invoked.VMWI already active in the channel for which the current registration of VMWI is being invoked.The conference connection being released does not exist.Trying to associate an invalid device.Given device is already associated with some other channel.bad message typeinvalid string Error opening voxprmpt.pcm Error getting buffer Unable to create PCM stream Unable to associate PCM stream Unable to activate PCM stream play first 80 samples (of bg noise) fseek err fread err Unable to deactivate PCM stream Unable to destroy PCM stream ???voxprmts.pcmrbsrc/ms_create.cMediaStreamAssociateChannel():AudioVideoData ImageLine StopTX transmitRX receiveTXRX bidirectional%s %spTxpRxpT38xCapCmnxCapAudhRtpInstxCapT38G711_ALAWG711_ULAWG729_ABG729_EG723_LORATEG723_HIRATEG726_40KBPSG726_32KBPSG726_24KBPSG726_16KBPSPCMCALLER_IDTONET38UNDEFINEDMAX_TYPEENCODEDECODET38_TXT38_RXMediaStreamGetCap(): StartedMediaStreamGetCap(): PROTOCOL_MEDIA_DATA T38_SUPPORTMediaStreamGetCap(): Endedsrc/ms_system.cVLANTAG_RTPPRIORITYTAG_RTPT38_ECC_COUNTMediaStreamAddCap: pCapMSMediaStreamAddCap: pCapLine 0 %s %s %s Stream ID%s%s: %ld%s Stream type%s%s: %sTX/RXSTOPPEDRXTX%s Received packet(s)%s: %ld%s%sSent packet(s)%s: %ld%s Received octets%s: %ld%s%sSent octets%s: %ld%s Latency%s%s: %ld%s%sJitter value%s: %ld msec%s Lost packet(s)%s: %ld %s No active streams are found for line %dAJBjitter buffer mode to %s (%lums) pStream=%x, %x FIXEDADAPTIVEStream set jitter buffer mode to %s (%lums) MediaStreamStart():MediaStreamStop():MediaStreamSetTelephoneEventG726-16G726-24G726-32G726G726-40G723G723LG729EG729AG729G711UG711PCMUG711APCMA_NtpUpdate: %lx %lx (old %lx %lx) _NtpUpdate called with ZERO time - not valid! src/ntp.cNTPSERVERIPsrc/Api/AudApiCid.cAudioStreamCreate() eCodecType %d, oAudioSysComplexCodecSupport %d AudioStreamCreate() AUDIO_STREAM_DECODE eCodecType %d, oAudioSysComplexCodecSupport %d src/Api/AudApiStream.cChannel %d asso Tx %lx Channel %d asso Rx %lx src/Control/AddEncoder.cAudioUpdOutputGain() channel %ld:%ld dB, gain %x AudioUpdInputGain() channel %ld:%ld dB, gain %x src/Control/AddDecoder.csrc/Control/ControlDecoder.csrc/Utils/audiobuf.csrc/Utils/AudioStream.csrc/T38/ProcT38.csrc/Control/ControlEncoder.csrc/Api/AudApiInit.c/dev/mic_master/dev/spkr_master/dev/mic_ch%d/dev/spkr_ch%dsrc/Api/AudApiTerm.csrc/Control/RemoveEncoder.csrc/Control/RemoveDecoder.cAudioUpdToneStatus() dwChannel %ld, dwTone %lx, dwStatus %ld src/Control/ProcCtl.csrc/Control/MsgStream.csrc/Control/OutBuf.cInvalid command, V33 limited to 14,400 and 12,000 To much data received, discarding excess. [%6d] (%3d, %3d) src/term.csrc/init.csrc/CallerId.csrc/BFSK/DataLinkLayer.cBBBooosrc/BFSK/PhysicalLayer.csrc/plcinit.csrc/plcterm.csrc/ajb.csrc/term.csrc/AudacityT2/fullduplex.csrc/init.csrc/AudacityT2/kill.csrc/AudacityT2/create.csilsuppsrc/config.csrc/reg.csrc/unreg.csrc/term.csrc/tonesynth.csrc/init.csrc/init.csrc/rtp.cRTPInstanceDestroy():RTCPGetReports():RTCPSendRRReport():RTPTxEvent(): ### TX 1 ###src/rip_table.csrc/rip_if.cROUTERXENABLEROUTETXsrc/dhcpserv.cIF%dNETCONFROUTEDxid does not matchrequested IP does not match offered IPrequested IP not on this subnetrequested IP already assignedunknown bindingmissing or invalid ciaddrDHCPPOOLMINDHCPPOOLMAXIPDNS1IPDNS2DHCPDOMAINDHCPMSGTIMEOUTDHCPLEASETIME%uDHCPSCANLEASESYESRe-Scanning the network for given leases! DHCPSTATICIP%dDHCPSTATICID%dDHCPSTATICIDTYPE%dHOSTNAME%02X%02X%02X%02X%02X%02XDHCPSERVENABLEDSTARTDHCPTABLEENDDHCPTABLELOADCLIENTDHCPCLIENTNAMEDHCPCLIENTIP%ld.%ld.%ld.%ldDHCPCLIENTCID%02XDHCPCLIENTLEASE%lu day%s %lu%s%lu%s%luhs :0:DHCPCLIENTTYPEStaticDynamicScannedUnknownBRIDGEONLYYCLEARDHCPTABLERequest to clear DHCPServer binding table DHCPSERVENABLEDDHCPSTATIC%ld days, %ldh %ldm %lds.PASSWORD$PWVALY.PASSWORD_USER$USER_PWVALCFGPARAMNAMEROMAVERSION%d.%d %c%c (%c%c%c%c %c%c%c%c%c%c)ROMBVERSIONROMATYPE%c%c%c%cFJB_DELAYKEY_FWD_CONDITION*1KEY_FWD_ON*2KEY_FWD_OFF*3KEY_DND_ON*4KEY_DND_OFF*5KEY_TRANSFER*98KEY_LAST_REDIAL*69KEY_LAST_ACCEPT*80KEY_LAST_BLOCK*60KEY_AUTO_REDIAL_ON*66KEY_BLOCK_CID*70KEY_AUTO_REDIAL_OFF*86KEY_ACR_ON*77KEY_ACR_OFF*87TIMER_AUTO_REDIAL1800DEAD_AIR_PERIOD0ADV_CALLINGEXTNO_ADVADV_CALLINGWAITING,WAITING_ID,CID,CONFERENCE,REDIAL_LAST,DIST_RINGS,TRANSFER,DND,FORWARD,BLOCK_LAST,AUTO_REDIAL,BLOCK_CID,ACRROMBTYPEMAC%02x:%02x:%02x:%02x:%02x:%02xSYSUPTIMESYSTIME DHCP_LEASEMOD_HW_211_CR_N_2005%dMOD_HW_201_N_2005PPTPENABLEDYESIF2IPADDRESS%ld.%ld.%ld.%ldIF2PIPADDRESSSNIFFED_MACS' ','%02X%02X%02X%02X%02X%02X'AUTHPSWDLINE%dAUTHPSWD******index.htmLOGOUTREDIRECT.REDIRECTNEWPASSWORDPassword removed NEWUSERPASSWORDUser password removed USER_LEVEL_ACCESSNUser level access removed. User level access allowed.SYSLOGD_ADDRESSMSG_SEVERITY_LEVELSYSLOG_CLIENT_PORTHTTP_ADMIN_LAN_ACCESSHTTPWANNO%ldJitterSet Fixed Jitter Buffer to [%d]ms JB_TYPEFIXEDFixed Jitter Buffer Adaptive Jitter Buffer AJB_MAXDELAYSet maximum Adaptive Jitter Buffer to [%d]ms CALL_FWD_LINE1CALL_FWD_LINE2RESETreset type [%s] STAGE1DNLDSTAGE1USENETCFGDNLDUSENETCFGSYSTEMDevice rebooted to downloader via web.Device rebooted to application via web.SYSLOG_SENDCONFIGALLMACSPOOFCLEARMNG_LOAD_NAMEDEFAULTDevice configuration reset to default from webIF0RATE_ENABLEIF0RATE_DYNAMICIF0RATE_UPLOADIF0RATE_LIMITpptp.htmfxolineu.htmrfc2833u.htmnatipsec.htmlogout.htmpwsetu.htmreset.htmforward.htmlanset.htmdhcptabl.htmdhcp.htmmacspoof.htmwanpppoe.htmwanset.htmnetinfo.htmmain.htmsubmenu.htmmainmenu.htmtop.htmindex.htm$PWVAL$USER_PWVALsrc/http.cGET POST HTMGIFJPGPNGJSCSSHTTP/1.0 200 OK Cache-control: no-cache Pragma: no-cache Expires: "Mon, 06 Jan 1990 00:00:01 GMT" Content-length: %d Content-type: %s text/cssxxxapplication/x-javascriptimage/pngimage/jpegimage/giftext/html/Content-Disposition: form-data; name= filename= -- Content-Length:multipart/form-data--boundary=%s %s?%s=%s$$ADMIN_IS_ONYNO""$HTTP_SERVER_PORTHTTP_ADMIN_LAN_ACCESSNUSER_LEVEL_ACCESS %c%s%cWEB_LINKVL_MEMBTYPE_CONFIG_UPDSTATUS_SPICIFIC_UPDSTATUS_SESION_UPDSTATUS_RESETSTATUS_LDR_UPDSTATUS_HTTP_UPDSTATUS_GENERAL_UPDSTATUS_APP_UPDSNMPWRITECOMMUNITYSNMPREADCOMMUNITYSHORT_NAME_PROJECTQUICKLY_DBGPRT_DEF_VLN OVER_MAX_LOCAL_TIMENEWUSERPASSWORDNEED_LDR_UPDATENEED_APP_UPDATENAME_PROJECTMNG_LOAD_TYPEMNG_LOAD_EXECUTELOCAL_UPDATE_DONELDR_UPDATE_DONEGEN_UPDATE_DONEDBG_MSG_CONF_FUNCCONFIG_SWITCHCNF_PCLI_HIDDEN_PSWCFG_PASSWORDA_CONF_SIMULAUTO_LDR_UPDATEAUTO_GEN_UPDATEAUTO_CONF_DHCPAUTO_CONFIG_ENABLEAUTO_APP_UPDATEAPP_UPDATE_DONEAPP_LOADER.PASSWORD_USER.PASSWORD$USER_PWVAL$PWVALConfigGetParam - error %d retrieving %s ConfigSetParam - Too long %s=%s %s Can't write to flash - parameter %s %s ConfigSetParam - wrote to flash - parameter %s NeenConfigCommit=%x SYSTEMSave Configuration faild. Enter changes and try again config2config1src/configparam.c!! Unable to open config filesNVRAM #%ld %s=%s %s #%ld %s=%s%s%ld%s ConfigSetParam Error %s=%s %s PrintConfigParam ConfigSetParam Error %s=%s Error #%ld Value Length=%ld Length=%ld %s PrintConfigParam Error #%ld pcpParam->oParamValueLength=%ld wLength=%ld Total: #%ld bytes=%d percent=%d %s Total: #%ld bytes=%d percent=%d$macWANMACSPOOF%02X%02X%02X%02X%02X%02X%c%c%s%c%c%s%c%c%s%c%c%s%c%c%s%c%c$versionv%d.%d.%c%c%c%c%c%c $modelAC-211$vendorTelco SystemsmacHW_VER_SIMULHW_VER_SIMUL_VALError in Configuration in NVRAM shadow memory HW_TYPE_SIMULHW_TYPE_SIMUL_VALDNS_DISCPerforming a SRV DNS Query for '%s' DNS Query failed! Found %d matching entries via DNS query src/dnsdiscovery.c No matches for TXT DNS Query. @:%d.%d.%d.%d DNS Entry - Priority %d - %s@%s:%d %s priority: %d weight: %d port: %d DnsDisplaySrvRecArray: null result! DnsDisplaySrvRecArray: 0 count! SRV DNS Query for %s succeededSRV DNS Query for %s failedPerforming a A DNS Query for %sA DNS Query for %s failedA DNS Query for %s succeeded, resolved by %ld.%ld.%ld.%ldFound %d matching entries via A DNS query for %sA DNS Query for %s - record with not valid IP address A DNS Query for %s - with 0.0.0.0 IP address A DNS Query for %s - with %ld.%ld.%ld.%ld IP address A DNS Query for %s succeededA DNS Query for %s - record with invalid IP address A DNS Query for %s - with 0.0.0.0 IP address src/protsrv.csrc/syslog.c%s/sysmqsrc/syslog_inter.c%s:%s<%d>VoIP_GW%s%s %s %s%sDecNovOctSepAugJulJunMayAprMarFebJan%s %2d %02d:%02d:%02dSYSLOGD_ADDRESSSYSLOG_CLIENT_PORTMSG_SEVERITY_LEVELsrc/resourcemgr.cin-progressfaildonestartedinvalidautoindirectdirectConfigurations errorHTTP failedinvalid applicationversion existsinvalid file namefile name not definedTFTP server not definedTFTP done. Incorrect versionTFTP failed quit,q - Quit console exit,ex - current mode and go to previous mode end,en - current mode and go to main mode list,l,? - Display command list help,h - Display commands format quit,q exit,ex end,en list,l,? help,h quitexitendlisthelp IPG > debug,d - Debug report,r - Report show,sh - Show System Information config,con - Config commands,com - Commands debug,d report,r show,sh config,con commands,com debugreportshowconfigcommands IPG.Config > mgcp,mg mgcp,mg - MGCP Configuration sip,si sip,si - SIP Configuration switch,sw bridge,b kendin,k rstp,r mac,ma h323,h3 http,ht vlan,v snmp,sn netconfig,n security,se temperature,t interface,i power,p switch,sw - Switch Configuration bridge,b - Bridge Configuration kendin,k - Kendin Configuration rstp,r - RSTP Configuration mac,ma - MAC Address Table h323,h3 - H323 Configuration http,ht - HTTP Configuration vlan,v - VLAN Configuration snmp,sn - SNMP Configuration netconfig,n - Network Configuration security,se - Advanced Security Configuration temperature,t - Temperature Configuration interface,in - Interface Configuration power,p - power Configurationswitchrstpbridgekendinmacsipmgcph323httpvlansnmpnetconfigsecuritytemperatureinterfacepowerlanwanpppoeroutenatdhcp IPG.Config.Network > IPG.Config.Kendin > IPG.Config.Snmp > IPG.Config.H323 > IPG.Config.Mgcp > IPG.Config.Temperature > IPG.Config.Bridge > IPG.Config.Switch > IPG.Config.SIP > IPG.Config.Network.Dhcp > IPG.Config.Network.Nat > IPG.Config.Network.Route > IPG.Config.Network.PPPoE > IPG.Config.Network.Wan > IPG.Config.Network.Lan > IPG.Config.RSTP > set,se - Set value in the Bridge register show,sh - Show contents of the Bridge register rlist,r - List registers of the Bridge set,se number_of_Register_Bridge|name value show,sh number_of_Register_Bridge|name|all rlist,rsetrlistall name of the Bridge register Show contents of the Bridge register value of the ConfBridge register name or number of the Bridge register Set value in the Bridge registerREG_INT3_MASKREG_INT2_MASKREG_INT1_MASKREG_INT3REG_INT2REG_INT1REG_G_CONT2REG_G_CONT1REG_ENREG_REV_IDREG_STATUS3REG_STATUS2REG_STATUS1REG_TDREG_LWW8REG_GNT2REG_GNT1REG_OGRREG_BFRREG_LWRREG_NARREG_EOPREG_PR set,se - Set value in the Switch register show,sh - Show contents of the Switch register rlist,r - List registers of the Switch set,se number_of_Register_Switch|name value show,sh number_of_Register_Switch|name|allseshr name of the Switch register Show contents of the Switch register value of the ConfSwitch register name or number of the Switch register Set value in the Switch registerREG_PORT_7_COUNTER_BLOCKREG_PORT_6_COUNTER_BLOCKREG_PORT_CONTROL_EXTEND_7REG_PORT_CONTROL_EXTEND_6REG_EASE_7REG_EASE_6REG_PORT_CONTROL_7REG_PORT_CONTROL_6REG_PORT_5_COUNTER_BLOCK REG_PORT_4_COUNTER_BLOCK REG_PORT_CONTROL_EXTEND_5REG_PORT_CONTROL_EXTEND_4REG_EASE_5REG_EASE_4REG_PORT_CONTROL_5REG_PORT_CONTROL_4REG_PORT_3_COUNTER_BLOCKREG_CONTROL_DRAM_CONFIGREG_PORT_2_COUNTER_BLOCKREG_DATA_DRAM_CONFIGREG_PORT_CONTROL_EXTEND_3 REG_PORT_CONTROL_EXTEND_2 REG_EASE_3REG_EASE_2REG_PORT_CONTROL_3REG_PORT_CONTROL_2REG_PORT_1_COUNTER_BLOCKREG_PORT_0_COUNTER_BLOCKREG_PORT_CONTROL_EXTEND_1REG_PORT_CONTROL_EXTEND_0 REG_EASE_1REG_EASE_0REG_PORT_CONTROL_1REG_PORT_CONTROL_0REG_CONTROL_DRAM_OPERATIONREG_CONTROL_DRAM_PARAMETERSREG_CONTROL_DRAM_CONFIGURATIONREG_DATA_DRAM_OPERATIONREG_DATA_DRAM_PARAMETERSREG_DATA_DRAM_CONFIGURATIONREG_CPU_PARAMETERSREG_FIFO_PARAMETERSREG_INGRESS_FILTERREG_HOL_BLOCKINGREG_PHY_ADDRESS_2REG_PHY_ADDRESS_1REG_SMIREG_SERIAL_PARAMETERSREG_SOURCE_ADDRESS_HIGREGREG_SOURCE_ADDRESS_LOWREG_GLINK_FRAMES_RECEIVEREG_GLINK_FRAMES_SENTREG_GLINK_BUF_THRESHOLDREG_RX_BUF_THRESHOLDREG_LW_WRITE_DRAM_HIGADDRESSREG_ADDRESS_QUERY_REPLYREG_INTERRUPT_MASKREG_INTERRUPT_CAUSEREG_CPU_SNIFFER_NUMBERSREG_LEDS_OVERIDEREG_AGIMGREG_VLANREG_DEVICE_NUMBERREG_TARGET_DEVICE_PORT_7REG_TARGET_DEVICE_PORT_6REG_TARGET_DEVICE_PORT_5REG_TARGET_DEVICE_PORT_4REG_TARGET_DEVICE_PORT_3REG_TARGET_DEVICE_PORT_2REG_TARGET_DEVICE_PORT_1REG_TARGET_DEVICE_PORT_0REG_TARGET_DEVICE_PORT_PCI REG_DMA_2_3_SELECTREG_DMA_0_1_SELECTREG_DEVICE_TYPEREG_STATUSREG_GLOBAL_CONTROL no,n - Delete value in the Kendin parameters set,se - Set value in the Kendin parameters show,sh - Show value of the Kendin parameters no,n parameters [no] set,se parameter value show,sh parameter|allnony name of the parameter Show value of the parameter value of the parameter Set value in the parameter show,sh - Show value of the Temperature show,sh no,n - Delete value in the parameters set,se - Set value in the parameters show,sh - Show value of the parametersphone-lineclear statistics tables filter multicast groups query-timers set show lan,la - Lan Configuration wan,w - Wan Configuration pppoe,p - pppoe Configuration route,ro - Configure routing nat,n - Configure NAT Port Forwarding to LAN dhcp,d - Configure DHCP serverFIXEDDHCPtransportdomain_namedplansipportsipserver_ipmanagementportdhcpsecurityadvsecuritycontactlocationnamewritecommunityreadcommunitytrapcommunitytrapaddressendpointdomainportcallagentaddresscallagent2cidname1cidnamedialplan2number1numbergatekeeperipfiletftpipautoconfigvoipgatewayvoipnetmaskvoipaddressdnsdomainnamednshostnameipdnsipgatewayipnetmaskipaddressoptions6667idtrdosippsipsmclowtrapctrapaep2c1cd2n1ngftavoipgvoipnvoipadnsddnshipdipgipnipaodhIP packet transport protocol (default = UDP)String (Used in registration as user@domainname)Number (Port number of the Secondary SIP server)a.b.c.d (IP address of the Secondary SIP server)Number (Port number of the Primary SIP server)a.b.c.d (IP address of the Primary SIP server)Number (Management Port)y|n (y-DHCP Security Enable n-Disable)y|n (y-Advanced Security Enable n-Disable)String (contact person)String (physical location)String (administratively-assigned name)String (Write Community)String (Read Community)String (Trap Host Community)a.b.c.d (IP address of the Trap Host)String (Endpoint Domain Name)Number (Port number of the MGCP call agent)String (Address of MGCP call agent)String (Caller ID for the unit 2)String (Caller ID for the unit 1)String (Dial plan matching string)Numeric (Phone number of the unit 2)Numeric (Phone number of the unit 1)a.b.c.d (IP address of H323 Gatekeeper.)String (Filename)String (TFTP server Address)y|n (y-Auto Config Enable n-Disable)a.b.c.d (IP Net mask)string (DNS domain name)string (DNS hostname)a.b.c.d (IP gateway)a.b.c.d (Net mask) a.b.c.d (IP address)y|n (y-DHCP options 66,67 Enable n-Disable)String (DHCP Automatic Config ID)y|n (y-Use DHCP | n-fixed IP)TRANSPORT_TYPEDOMAINNAMESERVERPORT2SERVERIP2SERVERPORTSERVERIPMANAGER_PORTDHCP_SC_ENABLEADV_SC_ENABLESNMPSYSCONTACTSNMPSYSLOCATIONSNMPSYSNAMESNMPWRITECOMMUNITYSNMPREADCOMMUNITYTRAPHOSTCOMMUNITYTRAPHOSTIPADDRESSENDPOINTDOMAINNAMECALLAGENTPORTCALLAGENTADDRESSCALLERIDNAME2CALLERIDNAME1DIALPLANLINE2NUMBERLINE1NUMBERGATEKEEPERIPMNG_LOAD_NAMEMNG_LOAD_IPAUTO_CONFIG_ENABLEVOICE_GATEWAYVOICE_MASKVOICE_IPIF0DNSDOMAINNAMEIF0DNSHOSTNAMEIF0IPDNSIF0IPGATEWAYIF0IPNETMASKIF0IPADDRESSUSE_DHCP_OPTIONS_66_67FILE_PARM_NUM_UPDATEIF0DHCPIF1DNSDOMAINNAMEIF1DNSHOSTNAMEIF1IPDNSIF1IPGATEWAYIF1IPNETMASKIF1IPADDRESSIF1DHCP IPG.Commands > switch,s - Switch commands bridge,b - Bridge commands ping,p - Ping command send,s - Send command copy,c - TFTP download software image/configuration default,d - set default configuration reboot,r - reset command ping,p [<1-100>] send,s (config,c|line,l) copy,c default,d reboot,r (power,p|downloader,d)pingsendcopydefaultreboot IPG.Commands.Reboot > IPG.Commands.Bridge > IPG.Commands.Switch > IPG.Commands.Send > IPG.Commands.Ping > reboot,r - Reboot command Reset & Execute Application or Downloader Reboot power|downloaderdownloader init,i - Init Bridge command init,iiniti init,i - Init Switch command Send Configuration or Line info Send config|line port send,s (config,c [start num]|line,l [port])linelpi Ping a host Ping [<1-100>] IPG.Debug > phy,ph - phy HW 201 run function ks,k - ks run function run,r - Run function print,pr - debug Print commands trace,t - Trace commands global,g - Global commands memory,m - Memory commands phy,ph ks,k run,r print,pr trace,t global,g memory,m atp|a number_of_ports fiber_optic|f|vdsl|v fiber_optic|f|vdsl|v number_of_ports atp function product|p a|b|d oem|o firm|f b|g run,r number_of_function|? number_of_function Run function ks,k number_of_function|? phy,ph number_of_function|?atpphyksrunprinttraceglobalmemory IPG.Debug.Memory > set,se - Set value in the memory show,sh - Show contents of the memory dump,d - Dump contents of the memory set,se (byte,b|word,w|dword,d) address value show,sh (byte,b|word,w|dword,d) address dump,d address sizedump Size Address Dump contents of the memory address type: (byte|word|dword) Show contents of the memorydwordwordbyteb value Set value in the memory IPG.Dedug.Global > set,se - Set value in the global variables show,sh - Show contents of the global variables glist,g - List names of the global variables set,se number_of_global|name value show,sh number_of_global|name|all glist,gglist name of the global variables Show contents of the global variables value of the global variables name or number of the global variables Set value in the global variablesdwMaxTimerInterruptsdwTimerInterruptswTlntdwTlntoTlnt IPG.Dedug.PrintDbg > set,se - Set value in the PrintDbg function show,sh - Show contents of the PrintDbg function flist,f - List names of the PrintDbg function set,se number_of_PrintDbg|name value show,sh number_of_PrintDbg|name|all flist,fflist name of the PrintDbg function Show contents of the PrintDbg function value of the PrintDbg function name or number of the PrintDbg function Set value in the PrintDbg functionPrDbgFunction9PrDbgFunction8PrDbgFunction7PrDbgFunction6PrDbgFunction5PrDbgFunction4PrDbgFunction3PrDbgFunction2PrDbgFunction1PrDbgFunction0PrDbgGtBrNABufPrDbgGtBrPRBufPrDbgNetRxPrDbgNetSndPckPrDbgRdMdioPrmPrDbgWrMdioPrmPrDbgHWriteRegPrDbgHReadRegPrDbgWriteRegwPrDbgReadRegwPrDbgSnd_lw_msgPrDbgMngoutPrDbgMngsetPrDbgMnggetPrDbgGaloutPrDbgGalinPrDbgMsglevelPrDbgMsg IPG.Dedug.Trace > set,se - Set trace of the diagnostic messages on/off set,se (on|off,of) on or off Set trace of the diagnostic messages on or offoffonof IPG >Size: Stop Disply trace... Disply trace..... IPG >New Value: IPG >Address: TelNet Close..... System Reboot..... ******* Show Global Menu: 0 boUseTelNet 1 lTelNetConnNo 2 STEP 9 Main menu LogOut: 0 No 1 Yes 9 Main menu Trace Menu: 0 Start 1 Stop 9 Main menu ReBoot Menu: 0 Power on reset 1 ShutDown 2 Reset & Execute Downloader 3 Reset & Execute Main Application 9 Main menu Show memory Menu: 0 Byte 1 Word 2 DWord 3 Dump 9 Main menu Set memory Menu: 0 Byte 1 Word 2 DWord 9 Main menu Main Menu: 0 Show memory 1 Set memory 2 Trace 3 Globals 4 ReBoot 5 LogOut Terminal session active!!! Only one operator interface session can be active. Confirm will logout the Terminal session!!! Press to confirm. > Invalid Username, Try again... Username: > Now is a good time for the menu... > Welcome !!! This telnet session will take over any other Direct/Indirect Console session Press ENTER to Proceed > Intruder Alert !!! Terminating Telnet Connection... Invalid Password, Try again... Password:> Password:> Welcome !!! IP Gateway (IPG) CLI Management Welcome !!! IPG 202 VoIP Gateway Version 3.5 Telnet Management BATM Advanced Communications www.batm.com (c) 2000 Username: *** Quit Done *** IPG.Config.Interface > set,se - Set controls of the port show,sh - Show controls of the port show,sh port|all set,se port control value name of the control Show controls of the port show,sh port|all value of the controlflowcontrolportfoduplexspeedstatesfull1000half1000full100half100full10half10autonegotiatetxfxFULL1000HALF1000FULL100HALF100FULL10HALF10AUTONEGOTIATEAdisableenablenot supported on this portinvalid parameterinvalid speed: port is 1000 M invalid flow control: oninvalid speed: port is not 100 M invalid speed: port is 100 M invalid speed: port is not full10 or full100 or full1000DISABLEENABLEDE IPG.Report > download,d - Configuration Download Status statistics,s - Statistics of the ports download,d statistics,sdownloadstatistics IPG.Report.Download > show,sh - Show Configuration Download Status IPG.Report.Statistics > reset,r - Reset the counters show,sh - Show value of port parameters reset,r port|all counter|all show,sh port|all parameter|allreset name of the counter Show value of port counterExtendedTypeTypeDuplexSpeedLinkRxUnderSizePacketsTxBroadcastPacketsTxMulticastPacketsDroppedPacketsRxMacErrorPackets1024_1522_Packets512_1023_Packets256_511_Packets128_255_Packets65_127_Packets64_PacketsRxLateCollisionPacketsRxCollisionRxJabberRxFragmentsRxOverSizeRxCrcErrorsRxMulticastPacketsRxBroadcastPacketsRxTotalPacketsRxTotalOctetsTxPackets RxPacketsTxOctetsRxOctets IPG.Config.Security > IPG.Config.Power > test,t - Test battery set,se - Set charger type 1|2 show,sh - Show power parameters test,t show,sh parameter|all set,se chargertype|c 1|2test Show parameters of the Powerdoor statuspulse counterinput power sourcebattery statuscharger typedoorstatuspulsecounterinputpowerbatterystatuschargertype21UnknownBattery LowBattery OkNo Battery IPG.Config.VLAN > rtp,rt - Sets rtp service call,ca - Sets call service management,m - Sets managment service excluded,exc - Sets excluded vlan igmp,i - Sets igmp service remove,re - Removes ports from vlan addports,a - Add ports to vlan or to default vlan delete,d - Deletes vlan create,cr - Creates vlan set,se - Enable/Disable vlans show,sh - Show vlans and/or services [no] rtp|rt || [no] call|ca | [no] management|m [no] excluded|exc VLAN-TAG [no] igmp|i | remove|re VLAN-TAG PORT-LIST addport|a VLAN-TAG PORT-LIST delete|d VLAN-TAG create|cr VLAN-TAG set,se enable|e|disable|d show,sh [no] rst (i|interface) <1-9> (pa|path-cost) <1-200000000>[no] rst (i|interface) <1-9> (l|link-type) auto|point-to-point|shared[no] rst (i|interface) <1-9> (e|edge-port) 0|1[no] rst (i|interface) <1-9> (pr|priority) <0-240[no] rst (m|max-age) <6-40>[no] rst (f|forward-delay) <4-30>[no] rst (h|hello-time) <1-10>[no] rst (p|priority) <0-61440>rst e|d show rst (i|interface) <1-9>yesrtpcallmanagementexcludedigmpremoveaddportsdeletecreate t|u (t-Tag u-Untag) PORT-LIST t|u VLAN-TAG PORT-LIST t|u tos|t (delete TOS) priority|p (delete PRIORITY-TAG) vlan|v (delete VLAN-LIST) vlan|v (delete VLAN-TAG) CR (carriage return) addport|a VLAN-TAG PORT-LIST tos|t (sets TOS) priority|p (sets PRIORITY-TAG) vlan|v (sets VLAN-LIST) vlan|v (sets VLAN-TAG) (Set to default VLAN for port) enable|e|disable|d (enable or disable VLANs) (show vlan|v-VLAN or service|s Service configuration) t|u (t-Tag or u-Untag) VLAN-LIST (VLAN list 1 2 3 ...) TOS (Type of Service number <0-16>) PRIORITY-TAG (Priority number <0-7>) PORT-LIST (Port list 1 2 3 ...) VLAN-TAG (VLAN-TAG number <1-4095>) VLAN-TAG PORT-LISTtospriorityservicev IPG.Config.HTTP > set,se - Set HTTP status show,sh - Show HTTP status set,se enable|e|disable|dG726G729G723 IPG.Config.VoIP >oemfirmclearproduct file - string File Name ip - a.b.c.d IP address of the TFTP serversrc/tlnt.c_tlnt Tlnt *** started *** TELNET_SERVER_PORT%s Error! Telnet max buffer size reached%ssrc/autoconfig.cIF1AC_POLLINGAC_POLL_MINUTES1AUTO_CONFIG_ENABLEMNG_LOAD_IPMNG_LOAD_NAMEAPP_VERSIONLDR_VERSIONAUTO_CONFSpecific Configuration Parameters *** Download failed ***FILE_PARM_NANEDownload successful FILE_PARM_NUM_UPDATEalways0Update Specific Configuration Parameters failedUpdate Specific Configuration Parameters is successfulAUTO_GEN_UPDATEENABLEFILE_GEN_PARM_NAMEGeneral Configuration Parameters *** Download failed ***Update General Configuration Parameters failedUpdate General Configuration Parameters is successfulSTATUS_SESION_UPDOVER_MAX_LOCAL_TIMEAC_POLL_LOADERFILE_PARM_NUM_NEW%ld.%ld.%ld.%ldSPICIFIC_UPD_REPEAT%s%s%02X%02X%02X%02X%02X%02X?mac=HTTPTFTP%s configuration file download of %s from %d.%d.%d.%d APP_FILE_NAMEAUTO_APP_UPDATELDR_FILE_NAMEAUTO_LDR_UPDATEWrong upgrader filename Wrong application filename USER_REMOVE_PASSY$USER_PWVALUSER_PASS%dADMIN_REMOVE_PASS$PWVALADMIN_PASSA_CONF_SIMUL10.2.71.47ipg_211.cfgSIMUL_IP_SERVERSIMUL_FILE_NAMESIMUL_ID_NAMEIF1DHCPFIXEDIF1L3PROTPPPOE%s255.255.255.255AUTO_CONF_DHCPTYPE_CONFIG_UPDyMNG_LOAD_TYPE%s The filename=%s must be configuration type ipg_xxx.cfg%s %s IP or filename is not definedNn %s ************ %s %s ************** STATUS_LDR_UPDSTATUS_APP_UPDSTATUS_SPICIFIC_UPDSTATUS_GENERAL_UPDSTATUS_HTTP_UPDNEED_APP_UPDATENEED_LDR_UPDATELOCAL_UPDATE_DONEGEN_UPDATE_DONELDR_UPDATE_DONEAPP_UPDATE_DONEMNG_LOAD_IP APP_LOADERCONFIG_SWITCHDBG_MSG_CONF_FUNCMNG_LOAD_EXECUTEHTTPFILERESET_AFTER_APP_UPDRESET_AFTER_CFG_UPDRESET_AFTER_LDR_UPDTFTP_SERVERIP %s Simulation %s %s %s IF1AC_PROTOCOLCNF_P%ld%s InitGalileoPort: dwPort=%ld boFirst=%ld %sBlock flow control=on flow control=offenable disableautonegotiatehalf10 full10 half100 full100 half1000full1000FXTX %s Port=%d %s %s %s %s %s%s SetPortParm dwOID=%ld dwConfigL2Iface=%ld dwPort=%ld dwSetParametr=%ld %s SetPortParm IFACE_ENABLE dwConfigL2Iface=0x%lx IfaceEnable=%ld dwSetParametr=%ld src/galut.c %s Switch stuck resetting %s *** InitIgmpRouterVlanTbl malloc ERROR g_pwIgmpVlanIdList=%lx g_pIgmpRouterVlanTbl=%lx %s Port=%d Enbl=%d DpSp=%d Flow=%d STP=%d BckP=%d Block=%d dwConfig=0x%lx=0x%lx o2=0x%lx o9=0x%lx o10=0x%lx o11=0x%lx o12=0x%lx o13=0x%lx PrBlc=%ld DelRxIgmp=%ld RxRstpBlck=%ld RxOtherBlck=%ld %d.%d.%c%c%c%c%c%c , .cfgipgFILE_PARM_NANEalwaysFILE_PARM_NUM_UPDATERESET_LOADERSTATUS_APP_UPDSTATUS_LDR_UPDOVER_MAX_LOCAL_TIMECheckDownloadFile endADV_SC_ENABLEDHCP_SC_ENABLEIP_SCRT_%dIP_MASK_SCRT_%d255.255.255.255MAC_SCRT_%d0x%c%c%s Advanced Security is Disabled%s Advanced Security oAdvSecurityivityEntries = %d%s Advanced Security=%x%s Advanced Security Entries = %d%d.%d.%d.%d%s Type=%x IP=%15s %02x%02x%02x%02x%02x%02xSYSTEMFlash Error - Device configuration reset to defaultHTTPTFTP %s %s Retries #%d Delay=%lu sec TtUu_%d %s The file name=%s must be xxxx%s_%d.rom APP_NOT_VALID1APP_FILE_NAME%dUNKNOW_TYPE_RESET %s Module Type Unknown resetting %02x%02x%02xMY_HALF_MACMY_MAC_ADDRMNG_LOAD_NAMECFG_PASSWORDipg_AUTO_CONFIG_ENABLE.rom 000%c%s_%s_%s%s%s%s HWrtPrtStatus: IndPrt=%ld HertzIndex=%ld portindex=%ld TypePort=%ld boFirst=%ld Copper PigtailHSSDC IIOptical pigtailSGMUMT-RJLCFiberJackFibre Channel coaxial headersBNC/TNCFibre Channel Style 2 copper connectorFibre Channel Style 1 copper connectorSCUnknown or unspecified1000BaseLX SM,SFP installed1000LX-SFP1000BaseSX MM,SFP installed1000SX-SFP1000Base-X1000-X 100BaseFX SM,SFP installed100BaseFX MM,SFP installed100FX-MM 100BaseFX100FX 100BaseTX100TX %ldRESET_TDRESET_LWERR_RX_GAL_CNTRRESET_USERIGMP_SPEC_QUERY_RESP_INT%d%sSNMPIFDESCR1IPGSHORT_NAME_PROJECTNUMB_PROJECTVoIP GatewayNAME_PROJECTNAME_PROJ_END%s %s Access VoIP GatewayAccess %s %s%sECG711UYES%sONG711AG723NOG729MAXRSIPDISCONCALLAGENTADDRESSMGCP_PORTNM_GAL_PORTSHW_MODULE_TYPE%d %sports FXS phonePHONE_PORTS_NAMEPHONE_PORTSport 100Base-FX%s-%d%s%s%d-%sNFX %s-%d%d-%sport VDSLport POTS phone(Life Line)VDSL%s-%d%s%s%d%s-%d%dport 10BaseTport 10/100Base-T/TXports 10/100Base-T/TXNot TX PortsSW_TX_PORTS_NAMESW_UPLINK_PORT_NAMEPHONE_POTSFO_PORTSPICIFIC_UPD_REPEATGENERAL_UPD_REPEATAPP_UPD_REPEATLDR_UPD_REPEATSTATUS_RESETSTATUS_SPICIFIC_UPDSTATUS_GENERAL_UPDSTATUS_APP_UPDSTATUS_LDR_UPDSTATUS_SESION_UPDTYPE_CONFIG_UPDFILE_PARM_NANEFILE_PARM_NUM_UPDATETFTP_SERVERIP%s CheckDownloadSession STATUS_SESION_UPD=%s boVerNotRequested=%dHTTPFILESTATUS_HTTP_UPDEND_DOWNLOAD_UPDATELDR_VERSIONAPP_VERSIONNEED_LDR_UPDATENEED_APP_UPDATE%s CheckDownloadSession LDR_INCORRECT_VER boVerNotRequested=%d%s CheckDownloadSession APP_INCORRECT_VER boVerNotRequested=%d%s CheckDownloadSession DLOAD_FAIL boVerNotRequested=%dHTTPTFTP%d.%d.%d.%dyY1n0$PWVAL.PASSWORD%02d:%02d%s %02d/%02dPMAMUpTime: %s SetDefaultConfig ASSERT(iMaxLen<=SNMP_MAXSTR_LEN); Can't write to ConfigSector - parameter %s %s SetDefaultConfig ASSERT(0) Can't write to ConfigSector - parameter %s VL_ENABLEIF0VLANTAGIF0PRIORITYTAGIF1VLANTAGIF1PRIORITYTAGPRIORITYTAG_CALLVLANTAG_CALLVLANTAG_RTPPRIORITYTAG_RTPTOS_VALUEGATEKEEPERIPSERVERIPSIP_IP_TOSWATCH_DOG_ENABLENETMAIN_SLEEPJB_TYPEFIXEDAJB_MAXDELAYFJB_FAX_DELAYFJB_DELAYAUTO_JB_SWITCHUSE_CEDUSE_CNGMAC_ZERO%cFAX_AECONOFFNONESIP_USER_NON_ESCAPEDCALL_ID_DOMAINSKIP_REQ_RE_TXSIP_UDP_T1SIP_UDP_T2OEM_TYPE^^%s^PSTN_ENABLEPSTN_START_TIMEG711APACK30G711ASSG711UPACKG711USSG723PACKG723SSG726ECG726ONG726PACKG726SSG729PACKG729SSA_CONF_DELAY_TIMEIF1AC_PROTOCOLUNKNOW_TYPE_RESETDELAY_PLAYFOR_CLEAR_COUNTPHONE_FOR_IPWAN##47926PHONE_FOR_IPADDR##472337PHONE_FOR_DHCPYES##3427937PHONE_FOR_DHCPNO##342766PHONE_FOR_DEFAULT##3332858CLI_HIDDEN_PSWSNMPWANSNMPLANSNMP_ENABLETELNET_ENABLEPLAY_CLIMAX_PACKET_WRITEWAIT_FORCE_LDRIGMP_MIN_QUERYIGMP_DEF_Q_INT%c%c%c%c%c%c%c%c%c%c%c%cCONFIG_SWITCHFIRM_CODE %s %s %s %s v%d.%dSNMPSYSDESCWEB_LINKset_config_parameters WEB_LINK Error ConfigSetParamset_config_parameters WEB_LNK Error ConfigGetParamBTM BatmFIRM_NAME_1T e l c o S y s t e m sFIRM_NAME_2BATM Advanced Communicationshttp://www.batm.com/http://www.mmm.com/volition/VOL Volition3 M V o l i t i o nset_config_parameters WEB_LINK Error ConfigSetParam set_config_parameters WEB_LNK Error ConfigGetParam RESET_AFTER_CFG_UPDRESET_AFTER_LDR_UPDRESET_AFTER_APP_UPDIS_TEMPERATURE_TRAPIS_LINKUP_TRAPIS_LINKDOWN_TRAPTEMPERATURE_POLLING_TIMETEMPERAT_HIGH_LIMITAUTO_QUIT_TIMEWAITING_RESET_TIMEUSE_DHCP_OPTIONS_66_67GAL_REQ_ONLYCHECK_LIMIT_GAL_REQMINUS_LIMIT_GAL_REQQUICKLY_DBGSTAT_POLLINGMGCP_DBGHTTP_ENABLEMAX_LOCAL_TIMECALL_SERVER_NAMEsip.udpTXT_SERVER_NAMEsipCALLSERV_ENABLETIME_WAIT_TFTPMAX_REPEAT_TFTPLAST_MEMB_QUERY_CNTSIP_RTPPORTNUMBERSSTUN_IPSTUN_PORTSIP_NAT_IPIS_SNMP_USEDCPU_INTERFACENUMB_IFLEARN_MY_MACDEL_QUERY_DUPLRSTP_ENABLEFDB_DELETEIGMP_DBGPRINT_MALRSTP_DBGFLTR_MC_TIMEMGCP_TRACE** UNKNOWN **CPU_HW_VERCHARGER_TYPEIS_DOOR_OPENED_TRAPIS_DOOR_CLOSED_TRAPIS_BATTERY_LOW_TRAPDBG_VOICE_IPVOICE_MASK255.255.0.0VOICE_IPVOICE_DHCPDHCPVOICE_GATEWAYConnector Value: 0x%lx %sConnector Value: 0x%lxGEN_UPDATE_DONEAPP_UPDATE_DONELDR_UPDATE_DONEAUTO_GEN_UPDATEFILE_GEN_PARM_NAMEAUTO_APP_UPDATEAPP_FILE_NAMEAUTO_LDR_UPDATELDR_FILE_NAMEipgcfgMNG_LOAD_TYPECOPY_LOAD_NAMEupgrAUTO_CONFIG_ENABLECOPY_LOAD_IP%s ERROR: invalid IP address of the %s server=%ld.%ld.%ld.%ld%s ERROR: invalid IP address of the %s server%s ERROR: invalid File Name=%s%s ERROR: invalid File Name%s ERROR: Auto Configurations is EnabledOverall Status INVALIDOverall Status STARTEDOverall Status DONEOverall Status FAILOverall Status IN_PROGRESS???Download Status INVALIDDownload Status DONEDownload Status TFTP_FAILEDDownload Status TFTP_DONE_INCORRECT_VERSIONDownload Status TFTP_SERVER_NOT_DEFINEDDownload Status FILE_NAME_NOT_DEFINEDDownload Status INVALID_FILE_NAMEDownload Status VERSION_EXISTSDownload Status INVALID_APPLICATIONDownload Status STARTEDDownload Status HTTP_FAILEDDownload Status CONFIG_ERRORType DIRECTType INDIRECTType AUTO %s=%s %s %s=%s 0x%02x%02x%02x##%dGALILEO_POLLING_MSECBP_ENABLEBP_START_ADRBP_START_ADR_MSKBP_END_ADDRBP_ENDADDR_MSKBP_VALBP_VAL_MSKBP_MODEBP_ENABLE_SETLOG_RPRT_STATISTDELAY_UNKN_RESETETH_HW_LBMODEM_TONEETH_S_LINK_SKIPPHY_INIT_DELAYRTP_LOGHAND_SET_LVLHAND_SET_DBGCALL_TIMER_PERCENTMGCP_LOG_LVLFLASH_LOGFLASH_LVLSYSLOG_EXTSYSLOG_EXT_LVLHANDSET_LOGHANDSET_LVLAPP_LOGAPP_DBG_LVLTRANSP_LOGTRANSP_DBG_LVLMGCP_ERR_IGNOREDECOD_TRACE_LVLMGCP_ERR_CNTRMGCP_TRACE_LVLSIP_TRACE_LVLLOOP_TFTP_WAITAUTO_CONF_OPTTCP_D_LVLUDP_D_LVLEND_P_LVLEND_P_DBGAUDIO_CLIDBG_MIB_COUNTFAST_PLAYCHECK_PHONEUNKNOW_TYPE_ERRZERO_PORT_ERRHAND_SET_CNTRDBG_CONTROLSKIP_CRC_CHECKDBG_MSG_MSGDBG_MSG_MSG_LEVELDBG_MSG_CONF_FUNCDBG_MSG_SNMP_ACCESSDBG_TRAPDBG_STMP_TBLDBG_MSG_SNMP_AGENTDBG_WRITE_CONFIGDBG_RSTP_PIMDBG_RSTP_PRSDBG_RSTP_PRTDBG_RSTP_PSTDBG_RSTP_TCMDBG_RSTP_PPMDBG_RSTP_PTXDBG_RSTP_PORTSTATEDBG_RSTP_TESTIGNORE_GIGADHCP_HI_DBGDHCP_HI_LVLDHCP_IP_DBGDHCP_IP_LVLAPPLOG_DBGAPPLOG_D_LVLARP_LIST_DBGARP_DBGARP_DBG_LVLETH_DBGETH_DBG_LVLSET_DBGSET_DBG_LVLNET_DBGNET_DBG_LVLICMP_DBGICMP_DBG_LVLIP2ETH_DBGIP2ETH_D_LVLSYSLOG_DBGSYSLOG_D_LVLDBG_PRNT_CNTPRNT_SCKT_NUMBSTRIP_TAG_RXSTRIP_TAG_TX$PWVAL_USER %s WAN and LAN can`n be the same subnet: %ld.%ld.%ld.%ld 192.168.100.1255.255.255.0IF0IPADDRESSIF0IPNETMASK %s New Lan IP address:%s LAN NetMask:%s %s Resetting ... IF0DHCPIF1IPADDRESS10.1.0.54IF1IPNETMASKIF0RATE_ENABLEIF0RATE_DYNAMICIF0RATE_UPLOADIF0RATE_LIMITIF0RATE_CURRENTOVER_MAX_LOCAL_TIMET38_SUPPORTG711_TO_T38T38_SET_FORCET38_PORTT38_NEW_STREAMMS_T38_SUPPORTSIP_T38T38_CANNAL_PORTTX_T38_PORTRX_T38_PORTAUTO_USE_MACFILE_HFILEDIR_HDIR?FILERING_FORMAT%d%s%sSERIAL_PORT_ENABLEDsrc/cnf_init.c%d%d%s%sNsrc/ks_init.cLOOP_RESET_CNTRKS_PORT_STARTSUPPORT_SNMPIF0BCASTIF0MCASTIF1MCASTIF1BCASTHW232_PORTSSPAN_ENABLEDTFTP_IF_IDXHW_211_PHYHW_211_MACHW232_FO_PORTKS_STATISTKS_INTERFPRINT_VLANQUEUE_DISABLE %s ControlKsWritePortStatusInit: First=%ld Port=%ld=%ld Enbl=%d DpSp=%d Flow=%d STP=%d BckP=%d Block=%d dwConfig=0x%lx=0x%lx o2=0x%lx o9=0x%lx o10=0x%lx o11=0x%lx o12=0x%lx o13=0x%lx PrBlc=%ld DelRxIgmp=%ld RxRstpBlck=%ld RxOtherBlck=%ld %s ControlKsWritePortStatusInit !boFirst oCnt_2=0x%lx oCnt_9=0x%lx oCnt_10=0x%lx oCnt_11=0x%lx oCnt_12=0x%lx oCnt_13=0x%lx %s flash First=%ld Port=%ld Enbl=%d DpSp=%d Flow=%d STP=%d BckP=%d Block=%d dwConfig=0x%lx=0x%lx o2=0x%lx o9=0x%lx o10=0x%lx o11=0x%lx o12=0x%lx o13=0x%lx PrBlc=%ld DelRxIgmp=%ld RxRstpBlck=%ld RxOtherBlck=%ld %s ControlKsWritePortStatusInit end oCnt_2=0x%lx oCnt_9=0x%lx oCnt_10=0x%lx oCnt_11=0x%lx oCnt_12=0x%lx oCnt_13=0x%lx %s Port=%ld Enbl=%d DpSp=%d Flow=%d STP=%d BckP=%d Block=%d dwConfig=0x%lx=0x%lx o2=0x%lx o9=0x%lx o10=0x%lx o11=0x%lx o12=0x%lx o13=0x%lx PrBlc=%ld DelRxIgmp=%ld RxRstpBlck=%ld RxOtherBlck=%ld %s FID VID Membership Valid %s #%02ld %02ld %04ld 0x%02lx %ld%s FID UseFid Over Valid Forward MAC%s #%02ld %02ld %ld %ld %ld 0x%02lx %02X:%02X:%02X:%02X:%02X:%02X%s Valid Numbers Time Ready Port FID MAC%s #%02ld %ld %04ld %ld %ld %ld %02lx %02X:%02X:%02X:%02X:%02X:%02X%s #%02ld %20s %ldRxLoPriorityByteRxHiPriorityByteRxUndersizePktRxFragmentsRxOversizeRxJabbersRxSymbolErrorRxCRCerrorRxAlignmentErrorRxControl8808PktsRxPausePktsRxBroadcastRxMulticastRxUnicastRx64OctetsRx65to127OctetsRx128to255OctetsRx256to511OctetsRx512to1023OctetsRx1024to1522OctetsTxLoPriorityByteTxHiPriorityByteTxLateCollisionTxPausePktsTxBroadcastPktsTxMulticastPktsTxUnicastPktsTxDeferredTxTotalCollisionTxExcessiveCollisionTxSingleCollisionTxMultipleCollision%ldIF0RATE_CURRENTKendin SwitchAC211 SW modification for cost reductionUnknown Hw 211 Type1 LAN port 4 LAN ports Unknown LAN portsVL_MEMB%sVL_MEMB_EXT%s%ssrc/cnf_vlan.cPRT_DEF_VLNIF1VLANTAG%dIF0VLANTAG%s wVlanIndex=%ld pUpdVL_MEMS_TBL=0x%lx %s j=%ld VLAN_MEMB_TAG All=%04lx Tag=%04lx uTag=%04lx %s j=%ld VLAN_MEMB_UNTAG All=%04lx Tag=%04lx uTag=%04lx %s%s,%s, %s Vlan define length=%ld > MAX=%ld Can't write %s=%s %s%d,%ldautonegotiatehalf10full10half100full100half1000full1000illegalunknownTrace mutex 0x%lx from thread %d Tag %x Owner %d %s Type %d Cnt %d LCnt %d Line %d File %s DestroyedNot Destroyedsrc/cnf_load.c IF0IPADDRESSIF1IPADDRESSNETSETChanging %s interface IP address to %s LANWANG726G729G723CFG_PASSWORDCFG_GEN_PSWDAUTO_CONFConfig File is decryptedConfig File decrypt failedNEED_APP_UPDATENOAUTO_APP_UPDATEENABLEAPP_UPDATE_DONEAPP_FILE_NAMESTATUS_APP_UPDNEED_LDR_UPDATEAPP_VERSIONAUTO_LDR_UPDATELDR_UPDATE_DONELDR_FILE_NAMESTATUS_LDR_UPDLDR_VERSIONPORT_CONFIGCREATE_VLAN_TAGCREATE_PORT_VLANSTRIP_TAGCREATE_VLANCHANGE_VLANDELETE_VLANPORT_DEFAULT_VLAN*** Error Default VLAN Port=%ld VLan=%d not found *** Error duplicate VLAN=%ld line=%ld and line=%ld *** %d,%d,%d,%d,%d,%d,%d,%d,%d,%s=%s len=%ld PRT_DEF_VLN%d%ld%sVL_MEMBVL_MEMB_EXTSetCnfPortDefVLanTbl %s %d,%d,%d,%d,%d,%d,%d,%d,%d,*** Error Create VLan nCnfVlanMembersEntries=%d > %d *** TUYESERROR! - More than one complex codec cannot be supported simultaneously.%sONEXT%sEXTWRITE_CONFIGThe configuration variable %s value wont be set in the FLASH.The configuration variable %s value will be erased from the FLASH.ADV_CALLINGOEM_TYPE^^%s^ADV_CALLINGDon't edit this line*** First line is not valid !!!always;'" = '"Conflicting HTTP and TELNET server ports. Reset ports to default values.HTTP_SERVER_PORTTELNET_SERVER_PORTG726-16G726-24G726-32G726G726-40G723G723LG729AEG729AG729G711UG711PCMUG711APCMA%s%s%ssrc/cli_cmnd.cListCmd node=%d %s %sphone-line,p - Show phone line status%s ListCmd unknown node=%d HelpCmd node=%d phone-line portHelpCmd unknown node=%d %s%s %s *** Unknown command: %s%s *** Uncompleted command%s *** Unknown global name: %s%s *** Unknown register name: %s%s *** Unknown parameter: %s%s *** Invalid parameter: %s%s Warning! Reset system (y/n) ?%s Warning! Reset system and execute downloader (y/n) ?SYSTEMDevice rebooted to application via telnet.Device rebooted to downloader via telnet.%s Send configuration to syslog? (y/n)?%s Send all line statistics to syslog? (y/n)?%s no such phone line %d%s Send line %d statistics to syslog? (y/n)?%s no such host %s%s PrintWdstatistics MaxWd=%ld MinWd=%ld MidWd=%ld WdCur=%ld WdCntr=%ld %s NameFirmBatm=%s FullNameFirmBatm=%s HdrNameFirmBatm=%s SupportWebFirmBatm=%s%s %s %s %s%s NameFirmVol=%s FullNameFirmVol=%s HdrNameFirmVol=%s SupportWebFirmVol=%s%s Name=%s Numb=%s NameNumb=%s Nm=%s Num=%sEthernet IP Gateway202%s Short=%s Name=%s Numb=%s NameNumb=%s Nm=%s Num=%s%s Warning! Set Default Configuration (y/n) ?TFTPIF1AC_PROTOCOLCFG_PASSWORDMANAGER_PORTDHCP_SC_ENABLE$PWVALSNMPREADCOMMUNITYDNSDOMAINNAMEDNSHOSTNAMEPRODUCT_TYPECHARGER_TYPEFIRM_CODEIF1NETCONFIF1IPNETMASKIF1IPGATEWAYIF1IPADDRESSIF1ENABLEDIF1DHCPIF0VLANTAGIF0NETCONFIF0MCASTIF0L3PROTIF0IPNETMASKIF0IPGATEWAYIF0IPADDRESSIF0ENABLEDIF0DHCPIF0BCASTOEM_TYPEHW232_PORTSHW232_FO_PORT9,E,A%s Set Default waiting ... %s *** Defaults Set reseting %s %02ld:%02ld:%02ld %02ld.%02ld.%04ld START_DOWNLOAD%s wPldVer=0x%x wHwSwVersion=%ld oConfigSwitch=%ld %ld days, %02ld:%02ld:%02ld%02ld:%02ld:%02ld%s *** DHCP configuration ***%s IP address = %d.%d.%d.%d%s IP Subnet Mask = %d.%d.%d.%d%s IP Gateway = %d.%d.%d.%d%s Domain Name Server IP = %d.%d.%d.%d%s DHCP Server IP = %d.%d.%d.%dHTTP%s IP address %s server = %d.%d.%d.%d%s Domain Name = %s%s Root Configuration File = %s%s ID Configuration File = %s%s DHCP data not valid. Command Reboot required%s %s Malloc=%ld Delta=%ld Max=%ld%s mal_total=%ld _mal_max=%ld InUcastPkts=%ld InNUcastPkts=%ld InDiscards=%ld InErrors=%ld InUnknownProtos=%ld OutUcastPkts=%ld OutNUcastPkts=%ld OutDiscards=%ld OutErrors=%ld IsVLAN=%x %s ConsoleAct=%ld HttpAct=%ld EthEnet=%ld LastHttp=%ld LastCli=%ld AutoQuit=%ld DeltHttp=%ld DeltCli=%ld STATE_INITSTATE_RXSTATE_TXSTATE_INPUTInvalidNOTINUSELISTENINGSENDINGRECEIVINGInvadidclear?helpDriver RX Packet RX Packet TX Drv Drop TX Arp RX Ip Packet RXIcmp RX Arp TX Ip Packet TXIcmp TX Interface packet statistics: %8s LAN Interface packet statistics: %8s%17s WAN%s%25d %s%25d %16d Show RX rate limit If %d BitRate %d MaxWindow %d Passed %d OverRun %d Clear Interface statistics Format: run 222 [clear|?|help] - Display Interface statistics Invalid Params Clear NetIfLimiter statistics Format: run 223 [clear|?|help] - Display NetIfLimiter statistics Invalid params%s 0 %sBridgeInitCmnd%s 1 %sFDB_DispTbl%s 2 %sSwitchInitCmnd%s 3 %sVLanTblInit%s 4 %sHcliPrintVlanTables%s 5 %sIgmpPrintTables%s 6 %sIgmpPrintGlobal%s 7 %sConfSwitchShowCmndGig%s 8 %sIgmpSetUnSupportedMcasts%s 9 %sPrintNonFldMcast%s 10 %sNonFldMcasAging%s 13 %sHPrintDevice%s 14 %sPrintCamNonFldMcast%s 15 %stest_pld_get_ver%s 16 %stest_single_read%s 17 %stest_single_write%s 18 %stest_block_read%s 19 %stest_block_write%s 20 %sPrintMalloc%s 21 %sPrintGalType%s 22 %sPrintTxRxCounter%s 23 %sIgmpVlanPrintTables%s 24 %sHcliPrintDefVlan%s 25 %sClearWdFlashParm%s 26 %sReadWdFlashParm%s 27 %sSetGetFlashParm%s 28 %s%s 29 %sSetFlashNameNumbProject%s 30 %s_SlicReadDbg%s 31 %s_SlicWriteDbg%s 32 %s_SlicReadBlockDbg%s 33 %sPrintGetPortMIBField%s 34 %sClearPortMIBField%s 35 %sGpioWatchDogDisable%s 36 %sConfigClearAll%s 37 %sPrintWdStatistics%s 38 %sPrintNameNumbProject%s 39 %sPrintVLanTblParm%s 40 %seeprom_set_get%s 41 %seeprom_set_config%s 42 %seeprom_get_config%s 43 %si2_set_vlan_test%s 44 %si2_set_all_vlan_connectivity%s 45 %sPrintKendinEepromMemory%s 46 %sClearKendinEepromMemory%s 47 %sPrintConfigParam%s 49 %sKendingDisable%s 50 %sKendingEnable%s 54 %s%s 57 %sPrintConfigKendin%s 58 %sTempSensorInit%s 59 %sgetCurrentTemperature%s 60 %sSendTrapLinkUp %s 61 %sSendTrapTemperatureHighLimit%s 62 %sTemperaturePollingStart%s 63 %sDisplayTimeLastUpdate%s 64 %sClearDownloadStatus%s 65 %sPrintAdvancedSecurityTbl%s 66 %sCheckEndOfString%s 67 %sClearAllPortMIBField%s 68 %sPrintAllPortMII_Status%s 69 %sPrintInitData%s 70 %sPrintPortVlanDefault%s 71 %sPrintAllPortMIBField%s 72 %sSetPortGalileoStatisticsCounter%s 73 %sPrintPortGalileoStatisticsCounter%s 74 %sSetAllPortGalileoStatistics%s 75 %sPrintAllPortGalileoStatistics%s 76 %sHClearPortMibVarParm%s 77 %sPrintPortCounterParm%s 78 %sPrintFree%s 79 %sInitMallocFreeTbl%s 80 %sPrintMallocTotal%s 81 %sDeleteErrorMalloc%s 82 %sUpTime%s 83 %sPrintConfigL2Iface%s 84 %sDeleteNotUsedFlashVar%s 85 %sSetPortParm%s 86 %sTestAdvSecurity%s 87 %sTestGalStatPortCounter%s 88 %sServerTelnetStart%s 89 %sCheck_GcHwDbg%s 90 %sGetGcHwStatusRegDbg%s 91 %sPritGcHwStatusReg%s 92 %sSetGcHwStatusRegDbg%s 93 %sAddFlashValue%s 94 %sChangeFlashValue%s 95 %sDeletFlashValue%s 96 %sGetFlashValue%s 97 %sSetFlashValue%s 98 %sGN_ClearAllVlanEntryParm%s 99 %sHcliPrintVlanParm%s 100 %smyOpts[TELOPT_ECHO]%s 101 %sSocketStateTCP%s 102 %sChangesConfigParam%s 103 %sDeleteConfigParam%s 104 %sAddGroupFlashValue%s 105 %sConfigGetParamName%s 106 %sPrintVlanDefined%s 107 %sPrintTagVlanDeviceTable%s 108 %sSetNumberFlashValue%s 109 %s_TelnetCloseSocket%s 110 %sPrintGalTypeDirect%s 111 %sPrintTestGC%s 112 %sPrintTestGalPhy%s 113 %smdio_read_write%s 114 %sGC_read_write%s 115 %sGC_read_Phy%s 116 %sGC_write_Phy%s 117 %s%s 118 %sPrintErrorCounters%s 119 %sGalReadRegister%s 120 %sGalReadCounter%s 121 %sGalWriteRegister%s 122 %sClearPortCounter%s 123 %sClearPortAllCounter%s 124 %sPrintfDWord%s 125 %sReadVlan%s 126 %sTestSizeOfTbl%s 127 %sPrintUpdateTblVLan%s 128 %sSiTaskClose%s 129 %sHttpTaskClose%s 130 %sPrintMGCPStruct%s 131 %sMgcpChangeSocketLocalIP%s 132 %sPrntNetConfTable%s 133 %sPrintIgmpVlanList%s 134 %sSnmpAgentInitialization%s 135 %sDisplayNetConnTable%s 136 %sDisplayConnStatus %s 137 %sDisplayNetConfTable%s 138 %sDisplayXferStats %s 139 %sDisplayUDPStages %s 140 %sDisplayTCPStages %s 141 %sDisplayOtherStages %s 142 %sDisplayARPList %s 143 %sDisplayFdList %s 144 %sDisplayMemUsage %s 145 %sDisplayEndPointNum %s 146 %sEepromRead%s 147 %sPrintIfCounterParam %s 148 %sPrintIcmpCounterParam%s 149 %sPrintActive%s 150 %sPrintCallServerName%s 151 %sAddVoIpIpIfAddrAndMask%s 152 %sIpTablePrint%s 154 %s%s 155 %sg_oCpuInterface%s 156 %sPrintMacStatCounterParam%s 157 %sPrintCamMyMac%s 159 %sPrint_Arp_Table%s 160 %sGetIfIpAddrType%s 161 %sPrintConfigPortTbl%s 162 %sSetCommonSocket%s 163 %sSetCurrentCliSocket%s 164 %sIgmpPrintStatistics%s 165 %sIgmpClearStatistics%s 166 %sIgmpPrintUserTables%s 167 %sLoopIgmpPrintUserTables%s 168 %sRsptPrint%s 169 %sGalPortSpanBlock%s 170 %sGalFastAddressAging%s 171 %s%s 172 %sprint_mgcp_data%s 173 %srsip_mgcp%s 174 %sPlayIPAddress init%s 175 %sPlayIPAddress test%s 176 %sPlayIPAddress%s 177 %sstun%s 178 %sPhy Read/Write%s 179 %sPrintCpuIfTable%s 180 %sClearCpuIfTable%s 181 %sGetPassFromMacAndFlags%s 182 %sPlayString1%s 183 %sBrkptResult%s 184 %sErrSimulat%s 185 %sDirectPhyRead/Write%s 186 %sMessages-Waiting%s 187 %sPrintOpenCliConnections%s 188 %sPrintOpenTCPConnections%s 189 %sTelnetTrace level%s 190 %sPrintTelnetSockets%s 191 %sAppLoad%s 192 %sRunCopyCommand%s 193 %sDisplayAutoConfigParam%s 198 %sSetWatchDogEnable%s 199 %sPstnStartTime%s 200 %sJitterBuffer%s 201 %sWatchDogSleep%s 202 %sTftpAddressResolver%s 203 %sAutoUseMac%s 204 %sInitDefaultConfig%s 205 %snumber_of_calls%s 206 %sSysLogConfigParam%s 207 %sHttpDowlnoad%s 208 %sRTPStatistics%s 209 %sGetMacInfo%s 210 %sSetMacInfo%s 213 %sWatchDogOpen%s 214 %sprint_MacZeroErrors%s 216 %sMacCoreRead%s 217 %sPrintManuCode%s 218 %sPrintMeterInfo%s 219 %sGetCpuHwVersion%s 220 %sNATInfo%s 221 %sPthreadInfo%s 222 %sPrintEthSpecificVlan%s 223 %sSetEthSpecificVlans %s 224 %sRoutingTable%s 225 %sShowIPTable%s 226 %sIpifStatistic%s 227 %sNetIfLimiterStatistic%s 230 %sShow memory usage%s 232 %sShow sniffed LAN mac table%s 233 %sClear sniffed LAN mac table%s 234 %sMac_Link%s 235 %sPPPoERestart%s 236 %sHandsetLineMerering%s 237 %sPrintPulseMetering%s 240 %sPrint open file descriptors%s 241 %sUdpRxCbkDropped%s Total free available memmory is %ld %s *** SetFlashNameNumbProject End ***%s _SlicReadDbg: SlSlic=0x%x SlAddress=0x%x SlCmnd=0x%x SlData=0x%x%s _SlicWriteDbg: SlSlic=0x%x SlAddress=0x%x SlCmnd=0x%x SlData=0x%x%s *** _SlicReadBlockDbg End %s Configuration Clear waiting 15 sec ... %s *** Configuration Cleared reseting %s *** PrintNameNumbProject End %s *** 54 End %s *** DisplayTimeLastUpdate End %s *** ClearDownloadStatus End %s *** PrintAdvancedSecurityTbl End %s *** CheckEndOfString End %s *** PrintInitData End %s *** PrintFree End %s *** InitMallocFreeTbl End %s *** PrintMallocTotal End %s *** DeleteErrorMalloc End %s UpTime: %s%s *** PrintConfigL2Iface End %s *** DeleteNotUsedFlashVar End %s *** SetPortParm End *** %s *** TestAdvSecurity End %s *** ServerTelnetStart End %s *** AddFlashValue End %s *** ChangeFlashValue End %s *** DeletFlashValue End %s *** GetFlashValue End %s *** SetFlashValue End %s Start = %x %s End myOpts[TELOPT_ECHO] = %x %s *** SocketStateTCP End %s *** PrintConfigParam End Start=%ld End=%ld CHANGED_VAL_%s ChangesConfigParam #%ld Not Found%s%ld%s ChangesConfigParam Error %s=%s%s *** ChangesConfigParam End Start=%ld Numer=%ld chFiller=%s %s DeleteConfigParam Error %s=%s%s *** DeleteConfigParam End Start=%ld Numer=%ld DUMMY_NAMEDUMMY_VAL%s *** AddGroupFlashValue entry =%ld name=%s filler=%s %s Flash #%d Not Found%s Flash #%d=%s%s Flash parameter #%d Not Found%s Flash parameter #%d %s=%s%s *** SetNumberFlashValue parameter #N=%d Value=%s End %s *** _TelnetCloseSocket #%d End %s ks_WriteReg reg=0x%lx Result=%ld=0x%lx Ok=%x%s ks_WriteRegister reg=0x%lx Value=%ld=0x%lx Ok=%x%s PrintfDWord dwResult=%u %s TestSizeOfTbl Bytes=%u EntrySize=%u Entrys=%u%s TestSizeOfTbl Bytes=%u EntrySize=%u Entrys=%u %s %s%s *** SiTaskClose %s *** HttpTaskClose %s *** PrintMGCPStruct End %s *** MgcpChangeSocketLocalIP End %s *** PrintNetConfTable End %s SnmpAgentInitialization End Ticks %ld gdwMaxConnNo %ld %s DisplayEndPointNum END_POINT_NUM=%d g_oInstMax=%d g_oNumHandsetLines=%d%s *** PrintIfCounterParam dwIndex=%ld %s *** PrintIcmpCounterParam End %s *** PrintActive End %s PrintCallServerName g_boUseCallServerName=%d g_szCallServerName=%s %s *** AddVoIpIpIfAddrAndMask End %s *** IpTablePrint End %s Cpu Interface %d CPU_HOST %s Cpu Interface %d CPU_HOST_IF_0 %s Cpu Interface %d CPU_IF_0 %s Cpu Interface %d CPU_HOST_IF_0_1 %s Cpu Interface %d CPU_IF_0_1 %s *** PrintCamMyMac End %s %s Print_Arp_Table End %s dwWanIpAddr=%ld.%ld.%ld.%ld g_wVlanAll=%d Type=%s%s dwIP_Addr=%ld.%ld.%ld.%ld g_wVlanAll=%d Type=%s%s g_dwLocalIpAddr=%ld.%ld.%ld.%ld g_wVlanAll=%d Type=%s%s IP_Addr=%ld.%ld.%ld.%ld g_wVlanAll=%d Type=%s%s g_dwVoiceIp=%ld.%ld.%ld.%ld g_wVlanCall=%d Type=%s%s IP_Addr=%ld.%ld.%ld.%ld g_wVlanCall=%d Type=%s%s g_dwVoiceIpGw=%ld.%ld.%ld.%ld g_wVlanCall=%d Type=%s%s dwIP_Gatekeeper=%ld.%ld.%ld.%ld g_wVlanAll=%d Type=%s%s *** PrintConfigPortTbl End %s %s SetCommonSocket Connect=%d phsSocket=0x%lx phsSocket=0x%lx%s %s SetCurrentCliSocket phsSocket=0x%lx phsSocket=0x%lx123.123.123.123%s *** PlayIPAddress ip=%s Init=%ld nPlay=%ld %s %s End %d.%d.%d.%d %s %s server [client port] [server port] can't look up: %s We are behind %s NAT with mapping: %d.%d.%d.%d:%d -> %d.%d.%d.%d:%d %s *** PhyWrite Dev=%d=0x%x Reg=%d=0x%x iValue=%d=0x%x %s%s *** PhyRead Dev=%d=0x%x Reg=%d=0x%x PhyRead=%d=0x%x %s%s *** PrintCpuIfTable End %s *** ClearCpuIfTable End %s GetPassFromMacAndFlags %02X:%02X:%02X:%02X:%02X:%02X = %d %s *** PlayIPAddress ip=%s dwSec=%ld %s eBrkptEnable = 0x%lx %s pBrkptEnableStartAddr = 0x%lx %s dwBrkptEnableStartAddrMask= 0x%lx %s pBrkptEnableEndAddr = 0x%lx %s dwBrkptEnableEndAddrMask = 0x%lx %s dwBrkptEnableValue = 0x%lx %s dwBrkptEnableValueMask = 0x%lx %s nBrkptEnableDataMode = 0x%lx %s bBrkptEnableSet = 0x%lx %s adwBrkptPcs[0]= 0x%lx %s adwBrkptPcs[1]= 0x%lx %s adwBrkptPcs[2]= 0x%lx %s adwBrkptPcs[3]= 0x%lx %s adwBrkptPcs[4]= 0x%lx %s adwBrkptPcs[5]= 0x%lx %s adwBrkptPcs[6]= 0x%lx %s adwBrkptPcs[7]= 0x%lx %s dwBrkptStatus = 0x%lx %s pBrkptDataAddr= 0x%lx %s pBrkptProgAddr= 0x%lx %s g_boTypeUnknownErrSimulat = 0x%lx %s g_boZeroPortErrSimulat = 0x%lx %s g_boGalNotRespSimulat = 0x%lx %s g_boIsTypeUnknown = 0x%lx %s g_oTypeUnknownResetCounter= 0x%lx %s *** DirectPhyWrite Dev=%d=0x%x Reg=%d=0x%x iValue=%d=0x%x %s%s *** DirectPhyRead Dev=%d=0x%x Reg=%d=0x%x PhyRead=%d=0x%x %sMessages-Waiting: yes voice-message: 9/0essage:/%s SIP_MWI_STUTTER=%s iPos=%ld iPosEnd=%ld SIP_MWI_STUTTER%s bug iPos=%ld iPosEnd=%ld 1OVER_MAX_LOCAL_TIMEDBG_MSG_CONF_FUNCA_CONF_SIMUL0DBG_MSG_MSG_LEVELWATCH_DOG_ENABLE%s g_boWatchDogEnable=%d%s %s CheckMaxMinLocalTime=%d=%d g_boPstnEnable=%ld g_boPstnStartTime=%ld g_dwPstnStartTime=%ld%s Jitter= [%ld]ms%s WatchDogSleep Started dwWaitingTimeSec=%ld %s%s WatchDogSleep Ended %sMNG_LOAD_IP%s TftpAddressResolver %s = %ld.%ld.%ld.%ldMNG_LOAD_NAMEAUTO_USE_MAC%s AUTO_USE_MAC=%s AutoUseMac=%d DirMacUse=%d HalfMacUse=%d%s len=%ld MNG_LOAD_NAME=%s %s AddMacString=%d AutoUseMac=%d DirMacUse=%d HalfMacUse=%d len=%ld %s Mac=%s Half=%s%s new MNG_LOAD_NAME=%s %s CFG_PASSWORD=%s %s AddMacString=%d AutoUseMac=%d DirMacUse=%d HalfMacUse=%d %s Mac=%s Half=%s%s new CFG_PASSWORD=%s %s InitDefaultConfig OemName=%s iErr=%d DefaultConfigEntries=%d %s%s SetOemDefaultConfig OemName=%s DefaultConfigEntries=%d %s%s SetOemDefaultConfig OemName=%s Length=%ld is e m p t y !! %s ***SysLogConfigParam End Start=%ld End=%ld %s Invalid line number. The valid numbers are in the range 1 to %ld %s Command syntax : r 208 %s *** Mac Zero Error Counters: Rx=%ld TxTotal=%ld TxIp=%ld TxVlan=%ld TxArp=%ld FdbAdd=%ld FdbFound=%ld ArpFound=%ld %s%s MacCoreRead: wMacMacCtrlShadow[wDevNum]=0x%x wDevNum=%d reg=0x%lx=%ld Result=0x%lx%s g_wManuCode=%ld g_wCurrentManuCode=%ld g_wHwCpuVersion=%ld %s GetCpuHwVersion: boResult=%ld CpuHwVersion=%ld=0x%lx%s GetHwType: boResult=%ld g_wHwType=%ld=0x%lx SRAM statistics %d bytes free heap %d num free chunks %d bytes total in free chunks %d bytes totally available If %d %02X:%02X:%02X:%02X:%02X:%02X Table cleared %s MacCoreRead: g_oHw211Type=%d boLink=%d DuplexSpeed=%ld wMacMacCtrlShadow[wDevNum]=0x%x wDevNum=%d reg=0x%lx=%ld Result=0x%lxLINE%dCALL_REVERSE_POLARITY%s oLineNumber=%d %s CnfGetParam_YES=%dCall Reverse the PolarityThe Call Polarity is Normal%s HandsetLineMerering: oLineNumber=%d dwPeriod=%ld CurrentSec=%ld %s %s%s usage: r 240 [a] a - print all descriptor details a%s UdpRxCbkDropped=%ld %s_%dLABEL_LONG_LONG_LONG_LONGVALUE_LONG_LONG_LONG_LONGLABEL_MIDL_MIDLVALUE_MIDL_MIDLLABEL_SHORTVALUE_SHORT%s%s Flash parameter #%d Not Found%s Deleted #%d %s=%s%s Flash Value %s Not Found%s Flash Value %s=%s%s SetFlashValue Ok %s=%s%s SetFlashValue Error %s=%sHTTP_CLIENT_PORTsrc/http_lib.cGET /%s HTTP/1.0 Host: %s MNG_LOAD_IP%sContent-Length: HTTP/%d.%d %dMNG_LOAD_NAME%s SetPortGalStatPortCounter Link Up rsip_mgcp Port=%ld=%d CallRSIP=%d RSIP=%ld Eth=%ld LnkDw=%ld Delta=%ld %s SetPortGalStatPortCounter Forward Up rsip_mgcp Port=%ld=%d CallRSIP=%d RSIP=%ld Eth=%ld LnkDw=%ld Delta=%ld HTTP_ENABLE0%s%s HTTP = %s1%s PORT number <1-%ld>%s PRIORITY-TAG number <0-7> %s VLAN-TAG number <1-4095> %s TOS number <0-255> %s PRIORITY-TAG number <1-7> %s TOS number <1-16> %s VLAN-TAG VL_ENABLE%s VLANs [%s]%s PORT%s %4ld%s ==========================================================%s VLAN DEFAULT%s %4ld %s %s UT-%s Service VLAN Priority TOS%s ------- ---- -------- ---IF1VLANTAGIF1PRIORITYTAG%s Management %s %sVLANTAG_CALLPRIORITYTAG_CALL%s Call %s %sVLANTAG_RTPPRIORITYTAG_RTPTOS_VALUE%s RTP %s %s %s%s can not create more than %d VLANs %s VLAN-TAG already exists %s VLAN-TAG %d does not exist%s VLAN-TAG in use for default can not remove %s VLAN-TAG %d has members, delete anyway (y/n) ?%s VLAN-TAG %ld does not existtu%s ** All VLAN members in a port must be taged or untagedPRIORITY_TAG_IGMP%s parameter:%s advsecurity|a (y-Advanced Security Enable n-Disable)%s dhcpsecurity|d (y-DHCP Security Enable n-Disable)%s ip%ldaddress|ip%ld (Management IP Address %ld)ADV_SC_ENABLE%s%s advsecurity |a = %sDHCP_SC_ENABLE%s dhcpsecurity |d = %sIP_SCRT_%ld%s ip%ldaddress=%15sip%ldip%ldaddress%s advsecurity|a y|n (y-Advanced Security Enable n-Disable)%s dhcpsecurity|d y|n (y-DHCP Security Enable n-Disable)%s ip%ldaddress|ip%ld a.b.c.d (Management IP Address %ld)%s a.b.c.d (Management IP Address %ld) , %sysrc/tlnt_inp.c%s. %s%s%d.%d.%d.%d%s.##### %s MatchVoiceConfig=%d TypePlay=%d=%s PlaySting=%d Channel=%d oEvent=%d EventString=%s %s %c%s%s%s *** PlayIPAddress %s nPlay=%ld %s %s PlayString1 ip=%s dwMSec=%ld %s$PWVALIF1DHCPIF1IPADDRESS10.1.0.54IF1IPNETMASK255.255.0.0IF1IPGATEWAYSYSTEMDevice configuration reset to default from webCLEAN_PSWIP_ADDRIP_WANDHCP_YESDHCP_NODEFAULTTEST%s parameter:%s %d|%s%s counter:%sunknownhalf10full10half100full100half1000full1000illegalFXTX %s Port=%ld %s Link=%s %s DuplexSpeed=%sUp DownBlock %s Port=%d %d|%s=%u%s %d|%s=%u%s Port=%d %d|link=%sUp%s %d|link=%s%s Port=%d %d|duplexspeed=%s%s %d|duplexspeed=%s%s Port=%d %d|%s=%s%s %d|%s=%s%s Icmp counters Start=%ld End=%ld %s #%ld InMsgs %ld%s #%ld InErrors %ld%s #%ld InDestUnreachs %ld%s #%ld InTimeExcds %ld%s #%ld InParmProbs %ld%s #%ld InSrcQuenchs %ld%s #%ld InRedirects %ld%s #%ld InEchos %ld%s #%ld InEchoReps %ld%s #%ld InTimestamps %ld%s #%ld InAddrMasks %ld%s #%ld OutMsgs %ld%s #%ld OutErrors %ld%s #%ld OutDestUnreachs %ld%s #%ld OutEchos %ld%s #%ld OutEchoReps %ld%s Interface counters Start=%ld End=%ld %s #%ld OperStatus %ld%s #%ld LastChange %ld%s #%ld InOctets %ld%s #%ld InUcastPkts %ld%s #%ld InNUcastPkts %ld%s #%ld InDiscards %ld%s #%ld InErrors %ld%s #%ld InUnknownProtos %ld%s #%ld OutOctets %ld%s #%ld OutUcastPkts %ld%s #%ld OutNUcastPkts %ld%s #%ld OutDiscards %ld%s #%ld OutErrors %ld%s #%ld OutQLen %ld%sSYSTEMDevice configuration reset to default from CLI$PWVALDevice configuration reset to default from CLI //////////////////////////////////////////////////////////////////// // // %s // // Application %s Version %d.%d.%s // Loader Version %d.%d.%s // WAN IP address %d.%d.%d.%d // LAN IP address %d.%d.%d.%d // MAC Spoofing %02x:%02x:%02x:%02x:%02x:%02x // MAC address %02x:%02x:%02x:%02x:%02x:%02x // Module type %s ** UNKNOWN ** // %s // CPU Hw Ver %s // CPU Hw Ver %d // CLI APPLICATION // UpTime %s // Real Time %s gorainbowatpmodevodebugipv SNMP ConfigurationOEM_TYPE%s oem=%s ^^%s^b%dFIRM_CODEgMNG_LOAD_EXECUTECOPY_LOAD_IPCOPY_LOAD_NAME%s download from %ld.%ld.%ld.%ld %s (y/n)?%s %sNetwork Configurationsendreg stunport stunserver_iprtp_port nat_ip transport domain_name dialplan sip_2_port sip_2_server_ipsipport sipserver_ip sestunpstunsrntdodisip_2_psip_2_ssippsipsSERVERREGISTERSTUN_PORTSTUN_IPSIP_RTPPORTNUMBERSSIP_NAT_IPTRANSPORT_TYPEDOMAINNAMEDIALPLANSERVERPORT2SERVERIP2SERVERPORTSERVERIPString (transport type TCP|UDP)String (Used in registration as user@domainname)String (Dial plan matching string)Number (Port number of the Secondary SIP server)a.b.c.d (IP address of the Secondary SIP server)Number (Port number of the Primary SIP server)a.b.c.d (IP address of the Primary SIP server)dialplan gatekeeperipdgGATEKEEPERIPa.b.c.d (IP address of H323 Gatekeeper.)%s H323 Configuration Parameters:%s gatekeeperip|g (IP address of H323 Gatekeeper) %s %dnumber |1n (string E164 number (alias) of the line 1)%s dialplan |d (Dial plan matching string) %s %dcidname |%dc (Caller ID string for the line 1) %s%s %s |%s = %sLINE%dNUMBER%s %dnumber |%dn = %sCALLERIDNAME%d%s %dcidname |%dc = %s%dnumber%dn%dcidname%dcNumeric (Phone number of the line %d)String (Caller ID for the line %d)%s SIP Configuration Parameters:%s %s |%s (IP address of Primary SIP Server)%s %s |%s (Port of Primary SIP Server)%s %s |%s (IP address of Secondary SIP Server)%s %s |%s (Port of Secondary SIP Server)%s %s |%s (Domain name)%s %s |%s (Send Registration Request)%s %s |%s (Dial plan matching string)%s %s |%s (Transport type TCP|UDP)%s %dnumber |%dn (String E164 number (alias) of the line %d)%s %dcidname |%dc (Caller ID string for the line %d)%s %dport |%dpo (Sip port for the line %d)%s %daec |%da (AEC for the line %d)%s %dusername |%du (User Name for the line %d)%s %dpassword |%dpa (Password for the line %d)%s %s |%s (NAT IP Address)%s %s |%s (RTP/RTCP Port Base)%s %s |%s (STUN server IP Address)%s %s |%s (STUN server Port)%s phone line%s no such phone line %d%s Phone number = %sYesNo%s Registered = %s%s Call Active = %s%s State = %s%s Local RTP port = %d%s Remote RTP port = %d%s Codec = %s%s %s |%s = %s%s *** SIP Server Settings ***%s *** Gateway Settings ***%s %dnumber |%dn = %sLINE%dCALLERID%s %dcidname |%dc = %sLINE%dPORT%s %dport |%dpo = %sLINE%dAEC%s %daec |%da = %sLINE%dAUTHUSER%s %dusername |%du = %sLINE%dAUTHPSWD*****%s %dpassword |%dpa = %s%s *** NAT Settings ***%s *** STUN Server Settings ***%s %dnumber |%dn = %s%dport%dpo%daec%da%dusername%du%dpassword%dpaUDPONString (Send Registration Request YES|NO)String (Sip port for the line %d)String (AEC for the line %d ON|OFF)String (User Name for the line %d)String (Password for the line %d)a.b.c.d (NAT IP Address)Number (RTP/RTCP Port Base)a.b.c.d (STUN server IP Address)Number (STUN server Port)CALLERIDNAME1CALLERIDNAME2SNMPSYSNAMESNMPSYSLOCATIONSNMPSYSCONTACT%s%s %s Pulse Metering Period = %ld(sec)%s Total Pulse Metering = %ld%s Call Time = %ld(sec)%s 2 %shw201_read_register%s 3 %shw201_write_register%s 5 %shw201_read_reg_low%s 6 %shw201_Write_Reg%s 9 %sGetMacCtrlShadow%s 10 %sSetMacCtrl%s hw201_read_register reg=0x%lx Result=%ld=0x%lx Ok=%x%s hw201_write_register reg=0x%lx Value=%ld=0x%lx Ok=%x%s #%ld Hw201_Read reg=0x%lx Result=0x%lx %s hw201_Write_Reg reg=0x%lx Value=0x%lx%s GetMacCtrlShadow Dev=%x Val=0x%x%s SetMacCtrl Dev=%x Val=0x%x%s #%d PrDbgMsg - TRUE print debug msg%s #%d PrDbgMsglevel - Level dbg msg 0-min 1-mid 2-max%s #%d PrDbgGalin - msg Inp Gal NA msg%s #%d PrDbgGalout - msg Out Gal NA msg%s #%d PrDbgMngget - msg Req Get FDB%s #%d PrDbgMngset - msg Req Set FDB%s #%d PrDbgMngout - msg Resp FDB Get Req%s #%d PrDbgSnd_lw_msg - msg SendLwWriteMessage%s #%d PrDbgReadRegw - msg read_regw%s #%d PrDbgWriteRegw - msg write_regw%s #%d PrDbgHReadReg - msg HReadReg%s #%d PrDbgHWriteReg - msg HWriteReg%s #%d PrDbgWrMdioPrm - msg write_mdio_param%s #%d PrDbgRdMdioPrm - msg read_mdio_param%s #%d PrDbgNetSndPck - msg net_send_packet%s #%d PrDbgNetRx - msg net_rx%s #%d PrDbgGtBrPRBuf - msg GetBrPR_Buf %s #%d PrDbgGtBrNABuf - msg GetBr_NA_Buf%s #%d PrDbgFunction0 - msg pld_reg_write%s #%d PrDbgFunction1 - msg pld_reg_read%s #%d PrDbgFunction2 - msg IGMP_QUERY%s #%d PrDbgFunction3 - msg IGMP_RPRT%s #%d PrDbgFunction4 - msg bMcastNonFlooding%s #%d PrDbgFunction5 - msg Function5%s #%d PrDbgFunction6 - msg Function6%s #%d PrDbgFunction7 - msg Function7%s #%d PrDbgbHTTP - msg bHTTP%s #%d PrDbgFunction9 - msg ConfFunc%s #%d PrDbgbSnmpAccess - msg bSnmpAccess%s #%d PrDbgboTrapDebug - msg boTrapDebug%s #%d PrDbgDbgWriteConfig - msg DbgWriteConfig%s #%d PrDbgStmpTbl - msg StmpTbl%s #%d PrDbgSnmpAgent - msg SnmpAgent%s #%d PrDbgFunction15 - msg gboFlashDbg%s #%d PrDbgbArpDbg - msg bArpDbg%s #%d PrDbgFunction17 - msg Function17%s #%d PrDbgbEthDbg - msg bEthDbg%s #%d PrDbgoEthDbgLvl - msg oEthDbgLvl%s #%d boFunction20%s #%d boFunction21%s #%d bNetDbg%s #%d oNetDbgLvl%s #%d boAddTag%s #%d bIcmpDbg%s #%d oIcmpDbgLvl%s #%d bIp2EthDbg%s #%d oIp2EthDbgLvl%s #%d bSysLogDbg%s #%d bDhcpHi%s #%d oDhcpHiLvl%s #%d bDhcpIp%s #%d oDhcpIpLvl%s #%d PrDbgRstpPIMqueue - msg RstpPIMqueue%s #%d PrDbgRstpPRSqueue - msg RstpPRSqueue%s #%d PrDbgRstpPRTqueue - msg RstpPRTqueue%s #%d PrDbgRstpPSTqueue - msg RstpPSTqueue%s #%d PrDbgRstpTCMqueue - msg RstpTCMqueue%s #%d PrDbgRstpPPMqueue - msg RstpPPMqueue%s #%d PrDbgRstpPTXqueue - msg RstpPTXqueue%s #%d PrRstpSetPortState - msg RstpSetPortState%s #%d PrRstpTest - msg RstpTest%s #%d PrDbgMsg=0x%x - TRUE print debug msg%s #%d PrDbgMsglevel=0x%x - Level dbg msg 0-min 1-mid 2-max%s #%d PrDbgGalin=0x%x - msg Inp Gal NA msg%s #%d PrDbgGalout=0x%x - msg Out Gal NA msg%s #%d PrDbgMngget=0x%x - msg Req Get FDB%s #%d PrDbgMngset=0x%x - msg Req Set FDB%s #%d PrDbgMngout=0x%x - msg Resp FDB Get Req%s #%d PrDbgSnd_lw_msg=0x%x - msg SendLwWriteMessage%s #%d PrDbgReadRegw =0x%x - msg read_regw%s #%d PrDbgWriteRegw=0x%x - msg write_regw%s #%d PrDbgHReadReg =0x%x - msg HReadReg%s #%d PrDbgHWriteReg=0x%x - msg HWriteReg%s #%d PrDbgWrMdioPrm=0x%x - msg write_mdio_param%s #%d PrDbgRdMdioPrm=0x%x - msg read_mdio_param%s #%d PrDbgNetSndPck=0x%x - msg net_send_packet%s #%d PrDbgNetRx =0x%x - msg net_rx%s #%d PrDbgGtBrPRBuf=0x%x - msg GetBrPR_Buf %s #%d PrDbgGtBrNABuf=0x%x - msg GetBr_NA_Buf%s #%d PrDbgFunction0=0x%x - msg pld_reg_write%s #%d PrDbgFunction1=0x%x - msg pld_reg_read%s #%d PrDbgFunction2=0x%x - msg IGMP_QUERY%s #%d PrDbgFunction3=0x%x - msg IGMP_RPRT%s #%d PrDbgFunction4=0x%x - msg bMcastNonFlooding%s #%d PrDbgFunction5=0x%x - msg Function5%s #%d PrDbgFunction6=0x%x - msg Function6%s #%d PrDbgFunction7=0x%x - msg Function7%s #%d PrDbgbHTTP=0x%x - msg bHTTP%s #%d PrDbgFunction9=0x%x - msg ConfFunc%s #%d PrDbgbSnmpAccess=0x%x - msg bSnmpAccess%s #%d PrDbgboTrapDebug=0x%x - msg boTrapDebug%s #%d PrDbgDbgWriteConfig=0x%x - msg DbgWriteConfig%s #%d PrDbgStmpTbl=0x%x - msg StmpTbl%s #%d PrDbgSnmpAgent=0x%x - msg SnmpAgent%s #%d PrDbggboFlashDbg=0x%x - msg gboFlashDbg%s #%d PrDbgbArpDbg=0x%x - msg bArpDbg%s #%d PrDbgoArpDbgLvl=0x%x - msg oArpDbgLvl%s #%d PrDbgbEthDbg=0x%x - msg bEthDbg%s #%d PrDbgoEthDbgLvl=0x%x - msg oEthDbgLvl%s #%d bSetDbg= %d%s #%d oSetDbgLvl= %d%s #%d bNetDbg= %d%s #%d oNetDbgLvl= %d%s #%d boAddTag= %d%s #%d bIcmpDbg= %d%s #%d oIcmpDbgLvl= %d%s #%d bIp2EthDbg= %d%s #%d oIp2EthDbgLvl= %d%s #%d bSysLogDbg= %d%s #%d oSysLogDbgLvl= %d%s #%d bAppLogDbg= %d%s #%d oAppLogDbgLvl= %d%s #%d bDhcpHi= %d%s #%d oDhcpHiLvl= %d%s #%d bDhcpIp= %d%s #%d oDhcpIpLvl= %d%s #%d boFunction37= %d%s #%d boFunction38= %d%s #%d boFunction39= %d%s #%d PrDbgRstpPIMqueue=0x%x - msg RstpPIMqueue%s #%d PrDbgRstpPRSqueue=0x%x - msg RstpPRSqueue%s #%d PrDbgRstpPRTqueue=0x%x - msg RstpPRTqueue%s #%d PrDbgRstpPSTqueue=0x%x - msg RstpPSTqueue%s #%d PrDbgRstpTCMqueue=0x%x - msg RstpTCMqueue%s #%d PrDbgRstpPPMqueue=0x%x - msg RstpPPMqueue%s #%d PrDbgRstpPTXqueue=0x%x - msg RstpPTXqueue%s #%d PrDbgbRstpSetPortState=0x%x - msg RstpSetPortState%s #%d PrDbgbRstpTest=0x%x - msg RstpTest%s #%d bSetDbg=%x %s #%d oSetDbgLvl=%x %s #%d bNetDbg=%x %s #%d oNetDbgLvl=%x %s #%d boAddTag=%x %s #%d bIcmpDbg=%x %s #%d oIcmpDbgLvl=%x %s #%d bIp2EthDbg=%x %s #%d oIp2EthDbgLvl=%x %s #%d bSysLogDbg=%x %s #%d oSysLogDbgLvl=%x %s #%d bAppLogDbg=%x %s #%d oAppLogDbgLvl=%x %s #%d bDhcpHi=%x %s #%d oDhcpHiLvl=%x %s #%d bDhcpIp=%x %s #%d oDhcpIpLvl=%x %s #%d boFunction37=%x %s #%d boFunction38=%x %s #%d boFunction39=%x %s #%d PrRstpSetPortState=0x%x - msg RstpSetPortState%s #%d PrRstTEST=0x%x - msg RstpTEST%s %s Parameters:%s|%s%s %s %s %s%s %s= %s%s *** Fixed IP configuration ***%s%s *** Automatic configuration ***IF1DHCP%s Using MAC in the file name: %s%02x %08lx %s %s%sShow BYTE: 0x%x %sShow WORD: 0x%x %sShow DWORD: 0x%lx %s #%d oTemperatureHighLimit= %d %s #%d TestSendCounter= 0x%lx %s #%d TestSendLength= 0x%x %s #%d nFDB_Entries= %d %s #%d g_boPlaySting = 0x%x%s #%d boNetSendPckt= 0x%x%s #%d boLoopGetPB= 0x%x %s #%d g_dwDbgControl= 0x%x %s #%d EtnMainDelay= %ld %s #%d g_dwDelayPlay= %d %s #%d boArpTX_Pack= 0x%lx %s #%d boIPEchoTXPk= 0x%lx %s #%d TX_Gal_Counter= %ld %s #%d g_dwHandSetControl= 0x%lx %s #%d AgeTime= %ld %s #%d TD_Wait_Counter= %ld %s #%d LW_Wait_Counter= %ld %s #%d AgeingCounter= %ld %s #%d AgeingMaxCntr= %ld %s #%d ERR_HW_T8L= %ld %s #%d ERR_HW_TD= %ld %s #%d ERR_FDB_NOT_FOUND= %ld %s #%d nFDB_Pntr= 0x%x %s #%d wPldVer= 0x%x %s #%d oHDevCounter= 0x%x %s #%d nMaxPorts= %ld %s #%d RunDevice= 0x%lx %s #%d TelnetRegDev= 0x%lx %s #%d dwTxPacketCount= 0x%lx %s #%d boPldWdToggleEnable= 0x%x %s #%d Err_TD_Wait_Counter= 0x%lx %s #%d dwRxErrMallocCounter= 0x%lx %s #%d boSimulatTdErr= 0x%x %s #%d dwCliTimeDelay= %ld %s #%d dwTemperaturePollingTime= %ld %s #%d dwDbgPrintCounter= %ld %s #%d dw_CurrentPort= %ld %s #%d dwObjIfEntryTable= %ld %s #%d dwStatisticsTimeOut= %ld %s #%d dwMaxTimeGalileoStatistics= %ld %s #%d dwGalileoStatisticsCounter= %ld %s #%d dwGalileoStatisticsCurrentPort= %ld %s #%d dwPortStatisticsTimeOut= %ld %s #%d dwPortStatisticsMaxLoop= %ld %s #%d boIsMngtActie= 0x%x %s #%d boIsAdvSecurityEnable= 0x%x %s #%d dwGalStatCurrentPortCounter = %ld %s #%d dwMaxGalStatErrorCounter = %ld %s #%d dwERR_RX_GAL_CNTR = %ld %s #%d dwDeleteErrorMallocMsec = %ld %s #%d g_dwIgmpProxyIp = 0x%lx %s #%d dwTimeTelnetAutoQuit = %ld %s #%d g_dwVoiceIp = %ld %s #%d g_dwVoiceMask = %ld %s #%d g_dwVoiceIpGw = %ld %s #%d g_dwTelnetTaskMsec = %ld %s #%d g_dwTemperatureMaxCounter = %ld %s #%d boGalileoPolling = %d %s #%d boTemperatureTrap = %d %s #%d boSetGalPortsContol = %d %s #%d oConfigSwitch = %d %s #%d boIsGC = %d %s #%d boTelnetInit = %d %s #%d gboFlashIsFull = %d %s #%d gboStripTagRx = %d %s #%d gboStripTagTx = %d %s #%d g_boGalNotResp = %d %s #%d g_boGalReqOnly= %d %s #%d g_oNumbReqGalMsg= %d %s #%d g_oMinusLimitDevLoopCounter= %d %s #%d g_boCheckLimitGalReq= %d %s #%d g_boSimulatGalReq= %d %s #%d g_boReadRegGC= %d %s #%d g_boHttpEnable= %d %s #%d g_boVoiceIpUsed= %d %s #%d g_boTrapLinkUp= %d %s #%d g_boTrapLinkDown= %d %s #%d g_boMgcpDbg= %d %s #%d g_oIgmpLevel = %d %s #%d g_boIgmpReports = %d %s #%d g_boIgmpJoin = %d %s #%d g_boIgmpGenQ = %d %s #%d g_boIgmpSpecifQ = %d %s #%d g_boIgmpUpdMemb = %d %s #%d g_boIgmpLeave = %d %s #%d g_boIgmpUnsupMcst= %d %s #%d g_boIgmpAgeing = %d %s #%d g_boIgmpReporTX = %d %s #%d g_boIgmpGenQ_TX = %d %s #%d g_oHandSetLevel = %d %s #%d g_boTypeUnknownErrSimulat = %d %s #%d g_boZeroPortErrSimulat = %d %s #%d g_boGalNotRespSimulat = %d %s #%d g_dwSysLogState = 0x%lx %s #%d nFDB_Entries = %d%s #%d g_boPlaySting = 0x%x %s #%d boNetSendPckt= 0x%x %s #%d boLoopGetPB = 0x%x %s #%d g_dwDbgControl = 0x%x %s #%d boIPEchoTXPk = 0x%lx %s #%d TX_Gal_Counter = %ld %s #%d g_dwHandSetControl = 0x%lx %s #%d AgeTime = %ld %s #%d TD_Wait_Counter = %ld %s #%d LW_Wait_Counter = %ld %s #%d AgeingCounter = %ld %s #%d AgeingMaxCntr = %ld %s #%d ERR_HW_T8L = %ld %s #%d ERR_HW_TD = %ld %s #%d ERR_FDB_NOT_FOUND = %ld %s #%d nFDB_Pntr = 0x%x %s #%d wPldVer = 0x%x %s #%d oHDevCounter = 0x%x %s #%d nMaxPorts = %ld %s #%d RunDevice = 0x%lx %s #%d TelnetRegDev = 0x%lx %s #%d dwTxPacketCount = 0x%lx %s #%d boPldWdToggleEnable = 0x%x %s #%d Err_TD_Wait_Counter = 0x%lx %s #%d dwRxErrMallocCounter = 0x%lx %s #%d boSimulatTdErr = 0x%x %s #%d dwCliTimeDelay = %ld %s #%d dwTemperaturePollingTime = %ld %s #%d dwDbgPrintCounter = %ld %s #%d dw_CurrentPort = %ld %s #%d dwObjIfEntryTable = %ld %s #%d dwStatisticsTimeOut = %ld %s #%d dwMaxTimeGalileoStatistics = %ld %s #%d dwGalileoStatisticsCounter = %ld %s #%d dwGalileoStatisticsCurrentPort = %ld %s #%d dwPortStatisticsTimeOut = %ld %s #%d dwPortStatisticsMaxLoop = %ld %s #%d boIsMngtActie = 0x%x %s #%d boIsAdvSecurityEnable = 0x%x %s #%d dwERR_RX_GAL_CNTR = %ld %s #%d dwDeleteErrorMallocMsec = %ld %s #%d g_dwIgmpProxyIp = 0x%lx %s #%d dwTimeTelnetAutoQuit = %ld %s #%d g_dwVoiceIp = %ld %s #%d g_dwVoiceMask = %ld %s #%d g_dwVoiceIpGw = %ld %s #%d g_dwTelnetTaskMsec = %ld %s #%d g_dwTemperatureMaxCounter = %ld %s #%d boGalileoPolling = %d %s #%d boTemperatureTrap = %d %s #%d boSetGalPortsContol= %d %s #%d oConfigSwitch = %d %s #%d boIsGC = %d %s #%d boTelnetInit = %d %s #%d gboFlashIsFull = %d %s #%d gboStripTagRx = %d %s #%d gboStripTagTx = %d %s #%d g_boGalNotResp = %d %s #%d g_boGalReqOnly = %d %s #%d g_oNumbReqGalMsg = %d %s #%d g_oMinusLimitDevLoopCounter = %d %s #%d g_boCheckLimitGalReq = %d %s #%d g_boSimulatGalReq = %d %s #%d g_boReadRegGC = %d %s #%d g_boHttpEnable = %d %s #%d g_boVoiceIpUsed = %d %s #%d g_boTrapLinkUp = %d %s #%d g_boTrapLinkDown = %d %s #%d g_boMgcpDbg = %d %s #%d g_oIgmpLevel = %d %s #%d g_boIgmpReports = %d %s #%d g_boIgmpJoin = %d %s #%d g_boIgmpGenQ = %d %s #%d g_boIgmpSpecifQ = %d %s #%d g_boIgmpUpdMemb = %d %s #%d g_boIgmpLeave = %d %s #%d g_boIgmpUnsupMcst = %d %s #%d g_boIgmpAgeing = %d %s #%d g_boIgmpReporTX = %d %s #%d g_boIgmpGenQ_TX = %d %s #%d ** g_oHandSetLevel = %d %s #%d oTemperatureHighLimit%s #%d TestSendCounter%s #%d TestSendLength%s #%d EOP_Counter%s #%d NA_Counter %s #%d nFDB_Entries%s #%d g_boPlaySting%s #%d boNetSendPckt%s #%d boLoopGetPB%s #%d g_dwDbgControl%s #%d EtnMainDelay%s #%d g_dwDelayPlay%s #%d boArpTX_Pack%s #%d boIPEchoTXPk%s #%d TX_Gal_Counter%s #%d g_dwHandSetControl%s #%d AgeTime%s #%d TD_Wait_Counter%s #%d LW_Wait_Counter%s #%d AgeingCounter%s #%d AgeingMaxCntr%s #%d boFlagAgeing%s #%d ErrorHardWare[ERR_HW_T8L]%s #%d ErrorHardWare[ERR_HW_TD]%s #%d ErrorHardWare[ERR_FDB_NOT_FOUND]%s #%d nFDB_Pntr%s #%d wPldVer%s #%d oHDevCounter%s #%d nMaxPorts%s #%d RunDevice%s #%d TelnetRegDev%s #%d dwTxPacketCount%s #%d boPldWdToggleEnable%s #%d Err_TD_Wait_Counter%s #%d dwRxErrMallocCounter%s #%d boSimulatTdErr%s #%d dwCliTimeDelay%s #%d dwTemperaturePollingTime%s #%d dwDbgPrintCounter%s #%d dw_CurrentPort%s #%d dwObjIfEntryTable%s #%d dwStatisticsTimeOut%s #%d dwMaxTimeGalileoStatistics%s #%d dwGalileoStatisticsCounter%s #%d dwGalileoStatisticsCurrentPort%s #%d dwPortStatisticsTimeOut%s #%d dwPortStatisticsMaxLoop%s #%d boIsMngtActie%s #%d boIsAdvSecurityEnable%s #%d dwGalStatCurrentPortCounter %s #%d dwMaxGalStatErrorCounter %s #%d dwERR_RX_GAL_CNTR %s #%d dwDeleteErrorMallocMsec %s #%d g_dwIgmpProxyIp %s #%d dwTimeTelnetAutoQuit %s #%d g_dwVoiceIp %s #%d g_dwVoiceMask %s #%d g_dwVoiceIpGw %s #%d g_dwTelnetTaskMsec %s #%d g_dwTemperatureMaxCounter %s #%d boGalileoPolling %s #%d boTemperatureTrap %s #%d boSetGalPortsContol %s #%d oConfigSwitch %s #%d boIsGC %s #%d boTelnetInit %s #%d gboFlashIsFull %s #%d gboStripTagRx %s #%d gboStripTagTx %s #%d g_boGalNotResp %s #%d g_boGalReqOnly%s #%d g_oNumbReqGalMsg%s #%d g_oMinusLimitDevLoopCounter%s #%d g_boCheckLimitGalReq%s #%d g_boSimulatGalReq%s #%d g_boReadRegGC%s #%d g_boHttpEnable%s #%d g_boVoiceIpUsed%s #%d g_boTrapLinkUp%s #%d g_boTrapLinkDown%s #%d g_boMgcpDbg%s #%d g_oIgmpLevel %s #%d g_boIgmpReports %s #%d g_boIgmpJoin %s #%d g_boIgmpGenQ %s #%d g_boIgmpSpecifQ %s #%d g_boIgmpUpdMemb %s #%d g_boIgmpLeave %s #%d g_boIgmpUnsupMcst%s #%d g_boIgmpAgeing %s #%d g_boIgmpReporTX %s #%d g_boIgmpGenQ_TX %s #%d g_oHandSetLevel %s #%d g_boTypeUnknownErrSimulat %s #%d g_boZeroPortErrSimulat %s #%d g_boGalNotRespSimulat %s #%d g_dwSysLogState %s Download Session Configuration Summary %s ======================================STATUS_SESION_UPD%s Overall Status = %sEND_DOWNLOAD_UPDATE%s End download session time = %sTFTP_SERVERIPHTTPFILE%s HTTP Download%s%s IP TFTP Server = %sHTTPTFTP%s IP %s Server = %sTYPE_CONFIG_UPD%s Update Type = %sSTATUS_SPICIFIC_UPD%s *** Root Configuration Update ***FILE_PARM_NANE%s File = %sFILE_PARM_NUM_UPDATE%s ID = %s%s Status = %sSPICIFIC_UPD_REPEAT%s Retries = %sFILE_GEN_PARM_NAMESTATUS_GENERAL_UPD%s *** General Configuration Update ***GENERAL_UPD_REPEATLDR_FILE_NAMESTATUS_LDR_UPD%s *** Loader Download ***%s Version = %d.%d.%c%c%c%c%c%cLDR_UPD_REPEATAPP_FILE_NAMESTATUS_APP_UPD%s *** Application Download ***%s %s Version = %d.%d.%c%c%c%c%c%cAPP_UPD_REPEAT%s flow control: on|on off|of%s %s%s port state: enable|e disable|d%s %s|%s%s port: port number%s control:%s state|s (port state enable/disable)%s duplexspeed|d (half or full duplex and speed )%s flowcontrol|f (flow control on/off)CNF_P89,E,AVLN_COMMON%dVLN_COMM_IF1EXCL_MANAG_VLANPRIORITY_TAG_IGMPIF1VLANTAGIF1PRIORITYTAGPRT_DEF_VLN1,0,0,0,0,0,0,0,1,0,0,0,0,0,0,0,0,0,VL_MEMB%d,87381,%d,131073,,0,,0,,0,,0,,0,,0,%d,87381,,0,,0,,0,,0,,0,,0,,0,src/reboot.c%sHW_201_MACHW_201_PHYHW232_PORTS %s hw201 PortIndex=%ld portindex=%ld flash_DuplexSp=0x%lx dwValue=0x%lx %s hw201 flash_DuplexSp=0x%lx conf_DuplexSp=0x%lx dwValue=0x%lx %s hw201 dwValue=0x%lx %s boIsFullDupl=%x reg=0x%lx Reg 0 : Basic Mode Control =0x%lx APP_LOADERH323 ApplicationMGCP ApplicationSIP ApplicationLoaderUNKOWN APPLICATIONsrc/gal_br.cTIMEZONEDSTYESNATIPSECTRAVERSEYNAT_BINDING_TIMEOUTNAT_TCP_BINDING_TIMEOUTTCP_USRSTART_PORT%s 1 %sks_PrintInfo%s 2 %sks_read_register%s 3 %sks_write_register%s 5 %sKspiRead%s 6 %sKspiWrite%s 9 %sQueryKsReadPortMibCounter%s 10 %sKsReadPortMibCounter%s 11 %sKsReadPortDropMibCounter%s 12 %sKsGetPortLinkStatus%s 13 %sKsGetPortDuplexSpeed%s 14 %sksWriteReg%s 15 %sprint_VLAN_tbl%s 16 %sprint_static_MAC_tbl%s 17 %sprint_port_CPU_counters%s 18 %sKs_SetVlanEntry%s 19 %sKs_SetStaticMacEntry%s 20 %sprint_dinamic_MAC_tbl%s 21 %sQueryKsReadPortMibAllCounter%s 22 %sDirectPhyRead%s 23 %sDirectPhyWrite%s 25 %sPhyRead%s 26 %sPhyWrite%s 30 %sMacCoreRead%s 31 %sMacCoreWrite%s 33 %sInitHwCpuVersion%s ks_WriteReg KS_READ_REGISTER reg=0x%lx Result=%ld=0x%lx Ok=%x%s ks_WriteReg KS_WRITE_REGISTER reg=0x%lx Value=%ld=0x%lx Ok=%x%s #%ld KspiRead reg=0x%lx Result=0x%lx %s KspiWrite reg=0x%lx Value=0x%lx%s QueryKsReadPortMibCounter Port=%ld wAddress=%ld dwValue=%ld boResult=%x%s KsReadPortMibCounter Port=%ld wAddress=%ld dwValue=%ld boResult=%x%s KsReadPortDropMibCounter Port=%ld wAddress=%ld dwValue=%ld boResult=%x%s KsGetPortLinkStatus Port=%ld RStatus=%lx%s KsGetPortDuplexSpeed Port=%ld%s ks_WriteReg KS_WRITE_REGISTER reg=%ld=0x%lx Val=%ld=0x%lx Read=%ld=0x%lx%s *** print_VLAN_tbl End %s *** print_static_MAC_tbl End %s *** print_port_CPU_counters port=%d End %s Ks_SetVlanEntry oFID=%02ld wVID=%04ld oMembership=0x%02lx boValid=%ld%s Ks_SetStaticMacEntry oFID=%02ld boUseFid=%ld boOverrideStp=%ld boValid=%ld oForwardingPorts=0x%02lx %02X:%02X:%02X:%02X:%02X:%02X%s *** print_dynamic_MAC_tbl End %s *** QueryKsReadPortMibAllCounter port=%d LoopReset=%d ResetRegCounter=%ld OverflowCounter=%ld End %s ** Port=%d PhyId is not valid**%s #%ld Port=%d oPhy=%x Hw211_Read reg=%ld=0x%lx Result=0x%lx %s DirectPhyWrite port=%d reg=%ld=0x%lx Value=0x%lx%s #%ld Port=%d Hw211_Read reg=%ld=0x%lx Result=0x%lx %s PhyWrite port=%d reg=%ld=0x%lx Value=0x%lx%s MacCoreRead: wMacMacCtrlShadow[wDevNum]=0x%x wDevNum=%d reg=0x%lx=%ld Result=0x%lx%s MacCoreWrite: wDevNum=%d reg=0x%lx=%ld val=%ld=0x%lxTFTP_CLIENT_PORTsrc/tftp.coctet%dsocket: %s bind: %s sendto: %s %d sending, retry after %d msec select: %s stun_send_receive: length = %d ATTRIB_MAPPED_ADDRESS AF = %x PORT = %d address = %d.%d.%d.%d ATTRIB_SOURCE_ADDRESS ATTRIB_CHANGED_ADDRESS ATTRIB_MESSAGE_INTEGRITY ATTRIB_REFLECTED_FROM ATTRIB_ERROR_CODE ATTRIB_USERNAME ATTRIB_PASSWORD Unknown attribute: %x Wrong size Got response with differen ID MSG_BINDING_RESPONCE MSG_BINDING_ERR_RESPONE MSG_SHAREDSECR_RESPONCE MSG_SHAREDSECR_ERR_RESPONE Unknown response type: %x responce length %d length=%d ============================== stun_testI ====================================== ============================== stun_testII ===================================== ============================== stun_testIII ==================================== src/stun.cUDP BlockedUDP OpenedFull ConeSymmetricRestrictedPort restrictedSymmetric firewallUnknown typesrc/message.cId dwR29 SchedInh Policy AttrFlag APri TPid OPri %2d %8lx %8lx %6d %8lx %4d %4d %4d Id I[Sec:nsec] E[Sec:nsec] ISec ITicks ESec ETicks LSec LTicks SSec STicks %ld:%ld%2d %11s %11s %2d %9d %3d %9d %2d %9d %3d %9d Id theadAddr wTag Evt WllCnt WCurItem DCurItem SCurItem %2d %9lx %4x %3d %6d %8lx %8lx %8lx %4x %4d %9lx Id JTag JEvt JCnt JCurItem JRetValue JoinValue %2d %4x %4d %4d %8lx %9lx %9lx ? Id StReserve StSize BegStack EndStack Flags ErrNo malloc Line File %2d %9ld %6ld %8lx %8lx %8lx %5d %6u %4d %s %2d terminated & stack freed, not yet detached%13lu %4d %s malloc_total malloc_total_max heapbasemin heapbase heapbasemax %12d %16d %11lx %8lx %11lx src/fd.csrc/contexte.csrc/devicee2.copen files/devices: Name:%s dev:%x flags:%x Total %d open src/syscallk.capp.exesrc/kinit.csrc/synch.csrc/devicee.csrc/fsnod.crbBRKPT_PCS_0%lxBRKPT_PCS_1BRKPT_PCS_2BRKPT_PCS_3BRKPT_PCS_4BRKPT_PCS_5BRKPT_PCS_6BRKPT_PCS_7BRKPT_STATUS BRKPT_DAT_AADDRBRKPT_PROG_ADDR%d%s192.168.100.1255.255.255.0/gpiogpioWATCH_DOG_ENABLEOVER_MAX_LOCAL_TIMEUNKNOW_TYPE_RESETSYSTEMDevice configuration reset to default END_DOWNLOAD_UPDATE/gpioGpioDirection - attempt to set input id %ld to output GpioDirMask - attempt to set input id %ld to output FlashChipWrite writing sector 0x%lx FlashChipWrite ERROR verify failed (src=0x%lx dst=0x%lx) FlashChipWrite ERROR alignment failure src/flashchip.c/flashfs/flashfs/flashfs/flashfs/rawFlashOpen root opened FlashWrite writing %ld bytes to %s NETCONFMCASTBCASTPPPOE_ACPPPOE_SRVPPP_LCP_ECHO_TIMERPPP_IDLETOPPP_PASSWORDPPP_USERNAMEIPTOSDNSHOSTNAMEDNSDOMAINNAMEIPDNSIPGATEWAYIPNETMASKIPADDRESSL3PROTPPPOEPPTPROUTEDIF%dVLANTAGIF%dPRIORITYTAG%02X%02X%02X%02X%02X%02XWANMACSPOOFTTL_STEALTHYESIF0ENABLEDETHIF0DHCPFIXEDIF0IPADDRESSBRIDGEDIF1ENABLEDIF%dMTU0255.255.255.255IF%dDHCPIF%dNETCONF10.1.0.54192.168.1.199IF%dSTANDARDCLIENTIDCUSTOMIF%dCICUSTOMIF%d%sIF%dIPDNS2%dIF%dENABLEDPORTFWDMIN%dPORTFWDMAX%dPORTFWDIP%dPORTFWDPROT%dUDPTCPBOTHBLACKLISTPORTMIN%dBLACKLISTPORTMAX%dBLACKLISTTHRESHOLDDMZ_SERVER_IPROUTEDESTIP%dROUTESUBNETMASK%dROUTEGATEWAYIP%dROUTEMETRIC%dROUTEINT%dIF%dPPTP_ECHO_TIMERENABLEDIF2PPTP_SERVERIF2PPTP_SERVER_IPPPTP_SERVER_IPsrc/setupnet.cIF2L3PROT0.0.0.0IF%dENABLEDYESIF%dNETCONFROUTEDmacMAC address is %02x:%02x:%02x:%02x:%02x:%02x MAC address CRC check failed IFTYPE_AMACCONNSTATUSDNSHOSTNAME_ADNSDOMAINNAME_AIPGATEWAY_AIPDNS_AIPNETMASK_ADHCP_AIPADDRESS_A%ld.%ld.%ld.%ld%02x:%02x:%02x:%02x:%02x:%02xDisconnectedConnectedUpConnecting...Acquiring IP...DownDynamicStaticETHPPPPPPOEIF%d%sIPDNSIF%dIPDNS%d_ALANSUBNET%ld.%ld.%ld.CPEPORTMIN1src/websubstcfg.cCPEPORTMIN%d%dCPEPORTMAX%dSTARTROUTETABLEENDROUTETABLELOADROUTEDESTIPROUTESUBMASKROUTEGATEWAYROUTEMETRICROUTE%luSIFROUTEIF%ldTYPEROUTE%s%sSRD src/socketio_accel.c%d.%d.%d.%d/dev/socket/tcp/dev/socket/udpscksrc/socket_lib.csrc/socket_ioctl.csrc/socket_tcp.c/dev/socket/tcpsrc/socket_udp.c/dev/socket/udp/dev/socket/tcp %s socket #=%d Family=%lx Type=%lx Protocol=%lx Ret=%ld gdwMaxConnNo=%ld %d.%d.%d.%dsrc/listen.csrc/netif.csrc/netmain.csrc/ping.cECHOREPLYUNREACHABLENO RESPONSE%ld.%03ld0%ld.%ld.%ld.%ld %s --- %s msec %ld.%ld.%ld.%ld %s Success: %ld (%ld%%) Failed: %ld (%ld%%) /dev/ether/locallink/dev/ether/uplinksrc/ethlink.csrc/netif_limiter.c%s Port=%u%s %s=%ldifInOctetsifInUcastPktsifInNUcastPktsifInDiscardsifInErrorsifInUnknownProtosifOutOctetsifOutUcastPktsifOutNUcastPktsifOutDiscardsifOutErrorsifOutQLensrc/pppoeconf.cTRAILEROFFSETNETCBKHINSTNETCBKPAYLOADMUTEXMALLOCFREELLDOWNLLUPCLOSEOPENNEEDPROCESSINGTLFTLSTLDTLUSETROUTINGIDSETIFSETOUTPUTPFNSETHINSTsrc/ppplibs_cbk.cSYSTEMWAN interface is connectedPPPDifferent IP address was negotiated - will reboot.src/routing_table.c Routing Table: %15s %15s %15s %4s %3s %6s %9s %4s DestinationSubnet MaskGatewayTypeTOSMetricInterfaceVlan-------------------------------------%ld.%ld.%ld.%ld%15s %15s %15s %4d %3d %6d %9d %4d Number of entries: %d src/dns.c.DnsUpdateInformation: %ld.%ld.%ld.%ld src/srvquery.c%husrc/gethostbyaddr.c.in-addr.arpa %s %s%s waiting... %s %s%s DHCP client reveived NACKDHCP client lease expiredDHCP client received changed IP address form serverDHCP client received not valid IP form serverDHCP client unknown error - RebootingSTATUS_SESION_UPDDHCPCheckAndLoadCfgFileOVER_MAX_LOCAL_TIMEsrc/dhcpclient.cIF%dDNSHOSTNAMESYSTEMWAN interface is connectedDHCPCLIENT_VENDOR_INFOsrc/tcpmain.csrc/udpmain.csrc/ipmain.csrc/ip2eth.csrc/arp.c%s ArpTableSize=%d ArpHashSize=%d%s #%d IfIdx=%ld %02x:%02x:%02x:%02x:%02x:%02x %s LastUsed=%ld State=%d%s *** ArpHashSize=%d *** %s IfIdx=%ld VLAN=%d %02x:%02x:%02x:%02x:%02x:%02x %ssrc/icmp.csrc/icmp_utils.csrc/igmp.csrc/igmp_utils.csrc/igmp_xmt.csrc/igmp_rcv.c224.0.0.1224.0.0.2224.0.0.1src/ip1ton.csrc/netmalloc.csrc/netconfig.cICMPIGMPTCPUDPESPAHRAWGRE???src/netfree.csrc/iptable.c%s oIfIdx=%d, IpAddr=%ld.%ld.%ld.%ld, IpMask=%ld.%ld.%ld.%ld, Type=%s Vlan=%d %s single entry only %s g_dwNetMask=%ld.%ld.%ld.%ld g_dwVoiceIp=%ld.%ld.%ld.%ld g_dwVoiceIpGw=%ld.%ld.%ld.%ld g_dwVoiceMask=%ld.%ld.%ld.%ld boUseTagMode=%x dwTableSize=%ld g_boUseVoiceGw=%x g_boNeedInitVoiceGw=%x g_wVlanCall=%d g_wVlanAll=%d wTagVlanValue=%dxMcastRepository UNKNOWNLOOPBACKBROADCASTMULTICASTMYADDRMYSUBNETOUTSIDEINVBCASTMULTICASTJOINEDMULTICASTJOINEDPROXYMULTICASTJOINEDSOCKPROXYPPPPEERANY???Table repository is empty %2s%17s%17s%20s%8s IfIP AddressSubnet MaskTypeVlan%ld.%ld.%ld.%ld%2d%17s%17s%20s%8d Print IPTable contants: Print McastTable contants: Print PPPTable contants: src/netpacket.csrc/pppoeclient.csrc/pppoeparser.csrc/ppp.csrc/ppp_utils.cAUTHENTICATEAUTHENTICATECONFTRAFFICDETECTEDIDLETOsrc/ipcp.csrc/pppcp.csrc/pppcp_utils.csrc/pppcp_action.csrc/chapclient.csrc/papclient.csrc/pptp.csrc/pptp_ctrl.csrc/pptp_ctrl_utils.c+ grp %d OverRun %d src/sierra/maccore.csrc/sierra/macext.cEtherDrv/dev/ether/uplink/dev/ether/locallinkPHY%d: PhyID 0x%lx does not match expected 0x%lx PHY%d: No MDIO access - compiled for Kendin KS899x PHY%d: Unsupported PHY type PHY%d initialization complete /ledledLINE%uREVERSE_POLARITYYESsrc/slicdev.c/slicslic/dev/mic_master/dev/mic_ch%dmic/dev/spkr_master/dev/spkr_ch%dspkrsrc/AudacityT2/spkr.cSpeaker[%d] -> Stream[%d] No TDM clock found - enabling as TDM clock master TDM clock found (measured FS=%ld expected = %ld) !!ERROR BAD TDM clock found (measured FS=%ld expected = %ld) src/AudacityT2/tdm_stream.csrc/AudacityT2/mic.cMic[%d] -> Stream[%d] src/initClib.c/host/stdin/host/stdout/host/stderr unknown errornot a ttyname too longfile already existsmemory block growth failurebad executable formatinternal errorrange error/bad argumentrange errordomain errorno more filesrename across drivesinvalid drive idinvalid memory blockout of memoryinvalid handleaccess deniedno more handlespath not foundfile not foundinvalid function numberdisk swap requestbad sectors on formatunknown devicemedia changedmedia write protectedgeneral mishapread failurewrite failureout of papersector not foundunknown mediaseek errorbad requestcrc errorunknown commanddrive not readyerrorOKno route to hosthost is downconnection refusedconnection timed outcan't send/recv after shutdownsocket is not connectedsocket is already connectedno buffer space availableconnection reset by peersoftware caused connection abortnetwork dropped connection on resetnetwork is unreachablenetwork is downcan't assign requested addressaddress already in useaddress family not supported by protocol familyprotocol family not supportedoperation not supported on socketsocket type not supportedprotocol not supportedprotocol not availablewrong protocol for socketdestination address requiredinvalid socket numberconnect already doneconnect in progress: . src/strdup.c0123456789abcdef(null)0123456789ABCDEFsrc/fclose.csrc/getbuf.csrc/lvl1isr.csrc/digitmap/digitmap.c!!T2RomGetBootType:magic flags are not validBoot block %lx-> %lx %lx %lx Boottype is %d /flashfs/raw{H~|nljhfdb`H Ph`P \<WDPWDg @d&@(P(x L`(Npb`X(@*P$`WF"pFWFjxWF WD 09]< <] WFXྠWP<W~LW|HWnDWl@Wj@ c "p -$`H@ c "p"@cp80H&P H $`-aD@ c  p -$`kD@ c H p @W~ WfWdWbW`z({H~|nljhfdb`HJ  P0DpP h`PDt` @"PLdWF$p| DWF_DP WDtX@dFd_Fd D LDWF@WFD_Jdp֠WWD_De]b"@WL r_N PH s4"P `"@i P ]`_D0_F@  4  a]E `0b0`֠h] ` @bi"P d]`#p&D DljpWFtbWDtFD|FFx TJ DTL|$TN\$@TDx~FD|\N *@\Db xPDz\ Pu$@*PxHWDi P_J WF.@WDtz`pWFp&bh`L|"@.P$ {XpgDhgFjgDl .PWDi @JWFi @WDp&"`L Dd .PWFd@dLD WLF |WN  f WD WF|i@P֠OWFx ] ]]D"PWD@D DDܾDxFWFx WDi@PWFt09WDWF gDdWFt&$PWD `@WFp(@,$P `(@$P`x W~W|WnWlWjWhWfWdWbW`z{H~|nljhfdb`b 0 pP@@#.@iPd  @֠֠@A@o"P "P ,oT$P\o  Po\ P\ o  Po\< '\ \@p\"p@o"P  $`Db@;$@J \ZT(00#p\8pTH@@#o@@Pod PT(o !?Pod: PTHo !?Po\ Po\& Po\6 Po\F ֠GT"P o $\"P o ֠G "PoT Po\ @֠T$ $W~<`Y0$0H @ #W~W|WnWlWjWhWfWdWbW`z!DJ@a {~|nljhfdb`DDpNW| p ֠^J"jf`@ D @$Hb0 &@ `֠\@&@ D"&@ ֠\D,"&@ ${֠]b.@D&@ D&@ ֠]b.@D&@ Dbb"+ &@ W ($ED0X9"$ (U @  ^ @ bdH"WFc`@FP%"Dܾ&@  @ *D @ Z@ D @ Z@ DȾ @ Z@ D",(&@Aa$!ab PTb00""($`&@@WJP!KJP P@Pb ֠u.@D.@*P, L֠yW~&@ c@ `"&@ c@ .@,*P LW~W|. WnWlWjWhWfWdWbW`z RX0p {~$h fdb`  @_F:Wf< @ i9"@ (@i  ֠W~$@b @ "i P @ `hS ` @i"P ֠W~$#"&@ $!c@ (@i  W~$Wh WfWdWbW`z({p~nlj|hxftdpbl`h p "@ <_ljPd 9fh` P; ;`  b `,@D!@0b0X  4HP^"@$P"@.PL dH $P"`WD&pWFDWDFD.@$P (` &pWF;gL`@@b `0DP *@9; PW~ ;`  b `,@D!@0b0X  4HPW~WnWlWj|WhxWftWdp" WblW`hz{@~|nljhfdb`  j'$P <4!} $@` Pj <֠Hh @p$@` Pi H  LDDa a $!DKa a $!DSa a $!a a $!?>. " bP0bF XY<@`baa0aa0$!Daa0aa0$!Daa0aa0$!aa0aa0$!VPVXaa0aa0$!Daa0aa0$!Daa0aa@ !pN]ZZ?>" bP0b XY<@`baa0aa0$!Daa0aa0$!Daa0aa0$!aa0aa0$!VPVXaa0aa0$!Daa0aa@ !`pNqZWD?>" bDP0bƐ<@` pXYbaa0aa0$!Daa0aa0$!Daa0aa0$!aa0aa0$!VPVXaa0aa@ !`@pN$W~W|WnWlWjWhWfWdWbW`z{~$| nljhf db` p ` $"f*<(;@@b@.Pj'b``@ ! D"@@b@h$@p p4Hi`$@P֠@qm$@,P@( $!WJXJ0pWD'  0WF\WJ`j&@WDdWFhqNP`$@WDlWFpqNP`W~DW|@Wn@FB0W~W`z{~` Ilr , f |@W~W`z{~@f<d8b4`0L$N&WFX Wf`@PKA4X,`X | b ` WNl@֠@$,D*DH$J&" N(_D* | b `@@d@֠*qh\* p*qh\@  \*004*WL\@\ *{WNhH&@sFWLd$P$@i&P W~@Wf P@P֠@qm@#W~DW|@WnP֠;@qm P@ P0 DnWHl@ bqWH"!  @ @ q>PP֠_0@ bqmP P0@ bWHp4! H 4`  4WFtW~dW|`Wn\WlXWjTWhPWfLWdHWbDW`@zh{~|nlj hfdb`H @@P@N,Jľi9 P" OWD0WF v )@D("WD0֠W~ "n DDFFDpDFFDDWF,2@ $`, $?(F!$@ D $D a$@ 0F $DWD,2@ $@ 0F $D a$0D@0 D!!$WF,2D@ D̸q;@  D &b(bPD"'WF,@  0b0f0s@a@WDWFqNP`WDĸqh@ Jc WF  4_HqG_J$`q @@(8$!@&b *'b qhX$P@(Pa0fb <@WD,`(P(&bWF=qh\HP \  4d 4%%@0'b ֠p(<@qm$P@P֠(@0@)(<@ (WDؾj(pPWF (i@PP"&DWFWDpWF`P b0X X bD  bD XF04֠0XF040& b0WDĸq5 (@WFĸq5@P`@b ,@q>,@$P+@ ab0WDf@.@j"@ P 0D  W~Wb W`z @֠  @? ? b@H0 @P@֠ @ 004֠ 0 E  0 {~`0@P@Pb@  `4`  KKK%|`W~za|M0060Y ' b X ֠W0F b {(~|nljhfdb` DpFrH @J LWnr `_F '(D |H`xb\DDDtDDpDh4L @ b@0bY0X  4 4@0@ b_D2dQF2_F2_D0  4D0u#H P@P֠"-@(@j "`0@ b t `HPA0 $"j/ l@b(0` P,@Y@q> P@P֠"f@qm@  @b(0 @qNJ*`0b_H_J0XqG @"&P<`WFPW~'EWоA VEW "VIܾ'& "@VEWbh pVENE|>ANE|>(0W~WbW`z {~b`VEW  "VIܾ'& "@VEWbh W~WbW`z {~db` H8 0J$`H`x P d!T"@֠&!"@8 0J bH"P6$@ PH8 0J$`H"P d!"@T"@֠&8 0J bH"P$@ PW~WdWbW`z{~` SJWFW~W`z {~`NEX SJWFT0T,8 LW~֠'#W~W`z {~pfldhbd`` LD^ $VI} TFDBLHQJ0SJT3 00P֠'|$֠'|$֠'mGJ"@I|@`0 PL\@8$0ەHr P@8 @0֠'|@8"@ fJLVW~VE@I[ WHISWHCWH8 08"0Jb였hWH"P/`t @hVG0[WH"PVCܨ  VE SVIܾC @VIWJە @VI8 0*0 @ $@T 0I|@ PL @ !@@ D֠:*0$ rە @(P 0809 P֠:$ 8 09 * ֠=($ 0( W~tWhpWflWdhWbdW``zx{~Dh@f<d8b4`0%( 0TX #w qH8 0J"`d`"T AcTQJLc@ ֠>) T00P֠>)$J֠>)$I֠>)$E֠>)$G֠>)$H֠>)$F(E`A500P֠>)$0֠>)$1֠>)$2֠>)$3֠>)$4֠>)$5֠>)$6֠>)$7֠>)$8֠>)$9֠>)$*֠>)$#֠>)$A֠>)$B֠>)$C$D$W~DLQ$P(`W~DWh@WfW~,&  P MHQ P`W~,Wl(Wj$Wh WfWdWbW`z0IQIQ0H@;, H֠>H @{~db @7` "@8 0O P8 0O"@Jﰀ8 0O"@J︀LQ ֠?7Ih0@Ih0O"@ PIh08 0O"@Jﰀ Ih08 0O"@J＀Ih0LQ Ih08 0J"`VI{&W~WdWbW`z {~x80ľJ dnW~x8 0,HJ؀gW~x80  Y8 0,HJ8 08 0qJ#1 VGe2֠?W~xz֠?E] G]8 0,HJ*NEi 8 08 0qJ,֠?W~xz  8 08 0qJH ֠?W~xz8 08 0qJl֠?W~xz8 0J8 0qN֠?W~xz8 08 0qJW~xz{~(j$h fdS}b`` @k ,80J d !P80,JD80J d 80,J֠@D80(J d "80,J"D"8(0(<dx`&$@(P"`$@J d H b$@@80LJ d 80,JDT*@80`J d 80,JT80pJ dH< T@80񄾡J dH< T@80񘾡J dH< TE}W~(Wj$Wh WfWdWbW`z0{~LhHfDd@b<`8  $P 8 U/@NG{T PVK{XU "`TdHUUUpT(PTLQXH8 0LQJH`L P d!0&@֠B)VT&PVT$P` @8 0LQJ @bȾ"P d @VT"P @8 0LQJ @"P d @8 0"@Jبd+T ֠@ @d+T @8 0LQJ @"P d)"@>J,L0#WH,8 08 0J WH, PەWJ0rەWJ0 [WH, P֠A SC$@LQ&PT( 8 0.Sn&@T4 (T0APTVST,@TVV6TK}LTfK}ȾUH8 0LQJH&P d-AXX8 0,&@J ֠A} 8 0,&@J0֠A} 8 0,&@J@֠A} 8 0,&@JP TV{AXX80`&P dT8 0,&@Jl֠AEXX8 0,&@Jt֠AAXX8 0,&@J|TEXXTVKXXVwH8 0LQJH&P d"Pf&@`r"@` 5o  fJ dDF pTHD֠Br @LFV`r`"@ 5o  THrJ ` 80> "PWF$ ֠B @r5$@W~0Wf,Wd(Wb$W` z8{~`Q T @5 W~ W`z{~b`  5 @ THT W~WbW`z {~b`  " LQ TTJ"@5 W~Wb W`z {~b`Q T 5 @W~" WbW`z {~,h(f$d b` ""@  0@ TbdF TDTr֠C TT(p5$@ @ @8 J!8 0:kW~,Wh(Wf$Wd " WbW`z0{~(f$d b` ` @  0 TH `dDF THDTNr֠C3 @T&p5$@ @"@8 J8 0:W~(Wf$Wd Wb W`z0{~0f,d(b$` C  0TH1T J W~05 @"@ T5oDWFW~0Wf,$ Wd(Wb$W` z8{~b`Q T _5 @W~" WbW`z {~QQJzW~z{~QQJW~z{~$d b` ` @   `dDF$pWqTHD֠C @@@WqTH$pW~$Wd WbW`z({~ b` ` @  `dDFNrWqTHD֠C @ @r@@WqTHNr @rW~ WbW`z({~Q@@ Wq W~z {@h@VG~@Q XW~ z{@h@VG~@Q XW~ z{~b`  8O "@"@P=<"@W~WbW`z {~D|@n<l8j4h0f,d(b$` .<JL @UWlX ֠FO   @ F`80> (P(@00PM֠F . P֠F ..@֠F ..@֠F ..@֠F ..@44MQ ..@MQ 8 0J48 0qMQ@֠F ..@֠F ..@WDL;(@P0=.@UU =.@2M Q$@MQ*MQ$@ P`UX*UXXUXU D8 4D$@*Pf"` p$P8 0d*T֠F .@(PU ֠F =.@$@WFL;(@P0=.@(PT+ $P T T+֠F .@(PUUM @֠F .@U U$@U`pUVE`t@@$@ fNMMW.@(P;(@ (@WFL;P0.@(P(@< P&`֠F .@(PU@U ֠F .@(PU U$@ x^U |80 $P֠F .@(P֠F ..@֠F ..@֠F ..@֠F ..@֠F ..@U ,@qTJ ֠GNE LQ T NE $@TJ:TL$@$@8 J8 0:_֠H7< )8 0qTJ ֠HLQ T  TB$@&P5 @ $@8 J8 0:֠H7 Ur, AB>$@$@ 8 J8 0:W~,( Wh(Wf$Wd WbW`z0{H~hfdb`( He  P00PVI}ZW~( LD"( ֠JWhT@ %LQ T@֠J@ CLQ T@֠J@2֠J@T@VG} CLQ T@֠J@֠J@ DL[ [;S$@֠JW~(  DNG & R R8 0$@LVLQ % 8 0qU #@<T8$0 .S$`U  -$`ەU @֠Oq@<LHQ $ $D@qUJ ֠SZNE LQ T NE $@UJ:UL$@$@8 J8 0:֠Ss<(P 8 0U P,@"P&`>*pLF0wW~8֠ZUWn4 @ MD1 D2D @ *VEXX' D TH 8 0 .S `:<D  ,LH p0VEXX F 8.0TF ֠Z6TF 8.0֠Z6 f TH 8 0 .S `PRD&@ ,  pD 8.0!( LU0TJ TD +$`HTF L֠Z2 (.@]l,P"`֠ZTW~8 D D TH 8 0 .S `jlD ,  pD W~8Wn4Wl0Wj,Wh(& Wf$Wd WbW`z@{~hfdb`D 0  8(0T,((p @)&@"PA&@"PYL &@֠ZD]"PL&@|"PLWF FgD DgF(pFL, PD(@& $@JTDkLo @`WD po'T$D"P(`*THW~WhWfWdWbW`z{~PfLdHbD`@D0 0 P| PL  OD8"0WF gH$T b@ .S"`D , "pOF( TLTL W~P֠[WfLgD&L֠[ T TD , "pT,J, W~PWfLWdHWbDW`@zX{~thpfldhbd`` @U >T 2D@ T&0 T&4֠[=LH LH0֠[H   LD" LD   TD 0H LD  HTF 8 0JLD  TD 0LD iHk (LDFTHDdFHdJF TD J" LHHF$'LD  H(,TJ F(@]$PLLD  D(@$Pd]LD ֠[LD D)(@$PLD]LD(LD  HLD !L LF  (@ZU H$`LD(@`$P$PIL(@TF (@0HJ8DLW~tWhpWflWdhWbdW``zx{~@n<l8j4h0f,d(b$` tD @ 0 p 8"0U$,b"pJLk$@o* @`WD po'T$D&"@  HT+ T,&@֠\HD, "p(@) P @ ֠\3"`(@[" P$`(@ P @ "`.S֠\E*(@ P ,@ P*"`&@*&@  DW~@Wn֠^2 W~z{~b`Q )+ @"֠^ZD PP H  @* @0H ֠^h֠^hW~WbW`z @PI ֠^֠^I Q p H {~0j,h(f$d b`*9D 0 @ 8 8"0bL, "p֠^+8 0J`($8 0 1,&"@ O &"@ P H        80XHx PW~0* Wj,Wh(Wf$Wd WbW`z8{~b` 8"0bL"` ?T j "`?Tk$   ( < @ +,8 0J @ .S"`xW~WbW`z {~4d0b,`( Ty8 0JT4A!T(T(@p)4(֠_4o4T48 0J"$ D!T(Ff$t$pD֠_\T4T4o(T48 0J"$ D!T(Ff$t$pDT4id83b"@ d8$`T4D8 0 LT `*WJ"@ d8$`T4DT `*WJ$PWD `$*VI~c  @ @ i8 =Bߐ @W~4Wd0Wb,W`(z8{~db` TD$֠`QTH+ ֠_TH @ THh @TH+֠_THTH*TH + ֠_TH @ TH qO @TH +֠_TH TH *TF-TH  $ ֠`RW~B$ ֠`RW~TH + ֠`TH q @TH TH *֠`PD)$ TH+ ֠`:THh @TH+TH*֠`PDTH$ D%$ W~WdWbW`z {~b` + T "P T W~WbW`z {~ b`  TTJ$,T ֠`T d oHTF4WDdF8W~ WbW`z({~<l8j4h0f,d(b$`  `PU8 0L*TP֠akUhUf(@8 0ULJ֠`UH8 0JULU`'@fD \80, L"@v(PL d @8 0J`fD00PHX$P,@au"P$`֠a`VG WLdUDT (PdD N$@"P80i ֠a`dD T$@"P80i dD T$@"P80i ,T*f"@֠akdD $@"P80i <֠a`dD $@"Pi ֠a`dD $@"P80i "@WD0&k@@W~, D$ (  &$@ C|&$@ D q p  W~,( Wh(Wf$Wd WbW`z0{~b` 8 1JT T TT T $ $T 8"1b"`.STj  $ ( , 4 8 M< M@ X P T D9   \ @eL t x 8 J7"`?T|8 J7"`?TTTT .S"` @ .S"`W~WbW`z {~$d b` TF }$00P"@  TF4e@ TD"@ \"@"@ 8 1֠r"@ TP4 RTF4 e@ "@ 8 1"PTDP@P@֠roW~$$ TDH"@ TDX"@ "@  8 1֠roW~$$ 8 1  `TH|8 J7žS `֠roW~$$ 8 1  `8 J7 `STH|TH|;֠roW~$$ "@ 8 1W~$$ Wd WbW`z({~L|HnDl@j<h8f4d0b,`( < ` @ە( PTH$ MM M ֠s*=nM&FMn* MM @ U 0qPL=U PF 81, TF0TDU P0PU0PTDTD  @TD  TF0TD֠s$@ D 81, PTFF0TDWFD PTDD  U PTD0TD֠sD PD @TD TF@  M0M@s,@.PW~L< ,@W~L< W|HWnDWl@Wj@     L!$D֠(0 7  L D֠ (0 7  ֠((Lh  U .S"`< @ -"`=,P,U `,@ .S"`@W~0Wn,Wl(Wj$Wh WfWdWbW`z8{~0j,h(f$d b` @U&VF 8 1 U", pE Pd;*@ `%LF 0 bbLF 0 0 0Q" LF 0 0 0  ֠bd .SUo,2*@W~0Wj,Wh(Wf$Wd WbW`z8{~` ` D ?E@D00PE  E E   D ?W~W`z{~ fdb` 8 1 @& 0 + $@֠@"@P* `"$@*$@W~ WfWd" WbW`z({~b` T  8 1.S .@  8 1- 30TDW~WbW`z {~b` T  8 1.S C@W~"@ 8 1- Hە@"PW~WbW`z {~db` TH "@֠aW~W~$@TH,2 Dە@$PW~WdWbW`z {~b`   W~T "@dDL FW~WbW`z {~(j$h fdb`f      d(8*1+j T"A(d8+ T $`d((P $ $`.STH $`.STH"@ .S$`T"ATd8,&<(@T",@'8$1 T, d88P,04 $`.STH $`.STH"@ .S$`T",AT,&@ (@ @ .S*`W~(Wj$Wh WfWdWbW`z0{~,h(f$d b` T 0D D 8 1, p@ !@f"@&PTHT H THTHdDL FL DT<H<T@H@d(@d8T֠$֠$-(`ľTTTDTD ֠t`` ` dD(D(T$P$T$$P d8?W~,T,֠4֠,4-(`ԾTTTD,TD0֠`,`0`0dD8D8T4P4T4$P W~,Wh(Wf$Wd WbW`z0{~$d b` TD  @  @ 8 1.S @D D81,   W~$` T @ TW~$Wd WbW`z({~b`  T8"1b .S"` @ .S"` W~WbW`z {~$d b` T @D 81,   W~$ TJ @dDTJW~$Wd WbW`z({~0f,d(b$` 0T 8 J38 1 `?P$  `.ST%0 *D 8 1, p@% @d& 2DDT+ ֠T!HPTH `*WJ8TT*@W~0Wf,Wd(Wb$W` z8{~$h fdb` f  ( (@ &&@ $$@ @W~$f @"PLD LF  dD  TJ (@TJ&@TJ$@W~$Wh WfWdWbW`z({~0j,h(f$d b` T @Q 8*1Q"! j '"@ !&b T*`.SPa *`.STb-g D 8 1, phD  ,U pTTUTW~0PU U$! '"@$P!&bW~0Wj,Wh(Wf$Wd WbW`z8{~,h(f$d b` T 0@8 J18 1? -W~,8 1 & @ @#! + &@֠t&@@ H P"@WJ*$`֠tWJ$`*&@W~,Wh(Wf$Wd WbW`z0{~(f$d b` 0T T8"1b .S"` @ .S"`D 81,  @ TdTW~(Wf$Wd WbW`z0{~ fdb` Wf8  "P $P&PW~ WfWdWbW`z({~$d b` T @ @  @ 8 1.S @! D81,  W~$LD LF LD LF TDTJDTLTN @W~$Wd WbW`z({~0n,l(j$h fdb`WfH WhLWjP WnXWlT "P $P&P(P*P,P .PW~0Wn,Wl(Wj$Wh WfWdWbW`z8{~ b`  T 8 1.S @ D 81,  @,"P W~ WbW`z({~,`(@@@@@    @ 8 1.S W~,W`(z0{~4d0b,`( T @@@@@ @   @ 8 1.S @) $D81,   W~4LD LF LD LF TDTFDTJFTDJTF DTJF TLTN @W~4Wd0Wb,W`(z8{~b` 8"1b "` .ST T .S"` @ .S"`W~WbW`z {~(f$d b`D   8&1, &p $@L` ,"P   @D , &p @,TJ `TD #D , &p@,TJ W~(Wf$$ Wd WbW`z0{~$d b` T  @  @ 8 1.S 0@5D 81,   TJ @TJTDTF  W~$Wd WbW`z({~(f$d b` 0T@ -"@ TH8 J58 1 ? `M"@ .S `NSD 81,  @ -T"@TD8 TJ6DW~(Wf$Wd WbW`z0{~ b` T "W~  8 1.S c@ gD 81,  @,"P W~ WbW`z({~ b`  T 8 1.S t@ yD 81,  @,"P W~ WbW`z({~$d b` T  @ @ 8 1.S @D 81,   TJ @,J W~$Wd WbW`z({~b`8 1 TF. E00PMH ֠ H ֠H ֠H9 ֠H9 ֠H ֠THo֠H ֠H ֠H ֠H ֠H ֠TH 8 1 .S `֠H ֠TH TH TH TH  8 1 `.STH֠H ֠H 8 1 "@.S W~WbW`z {~db` FW~    M    e$ T0"X$(T0 d< @ll"@֠> @lVE}TF\ 0)"PTDP@P@"@ 8 1\d֠@W~$$ TH|W~$$ THTF W~$$ %W~$$ Wd WbW`z({~`n\lXjThPfLdHbD`@a}d + T|q֠!`(*dT|oTH &TXP4@TQ E  da $@sb"P2(TXWD TXdDo&PoL֠~HTXdoPoL֠~HdT TQ 2Tda+T$@sb"P(*TTX$@ 8 1\TXWD TXdDo&PLeoRHe TX P֠TX$@ 8 1\TXT TXdoPoL֠~H(*TQ E  da $@sb$"P(*TXWD$ TXdDo&PoL֠~HTXdoPoL֠~HoTLdR yo81pm P TXQ&:dTQ ETXda $@TX sb,"PN(TXWD, TXdD֠z&PTXdPoLe Pe TXR֠dR)e PodPLdR֠P ֠(*e PodPLdRPfG}R bR;T|$@ P@T|,d"+ P T| +T|D4H4 T"T|ET|],$@l$@$PTP@P @֠T|֠T|T|*ZTHW~`Wn\WlXWjTWhPWfLWdHWbDW`@zh{~4h0f,d(b$` a}d + TH1֠!@LDn$`` WHTH֠THWHQ` 9 a 3 oWFPH $oWJQFLaHR QHXe oWHLaPPPaDRfG} b֠DR֠RaaR QHaRToWJQFLaHR He!8 1  P@@"@ hTNt `"PTDP@P@"@ 8 1\֠QHXe oWHaPLaRP֠ bRa oWFPH $ TH+H ֠THTH*0/DW~4Wh0Wf,Wd(Wb$W` z8{~(f$d b`& TL, TP8 1JdFd TD֠H|00PfE}'d'("@ \"@"@ 8 1\֠fE}n'di'"@  TF4e@TF"@ ("@ \"@"@ 8 1\֠8 1\֠d <'"@ 8 1\֠d.'"@ 8 1\֠d 'TDXP"PTDP@P@"@TD x"@ 8 1\:TDX֠'d"@& W~(Wf$Wd WbW`z0{~Dd@b<`8 H  T` T @T(n@DT T $T @T(NG~<H$DnP TJ$H(oH8 1J̾"`pTH$JH4oR d HXLH,"@$PsT (H,Z P"`T HTDLW~D "@W~DWd@Wb<W`8zH{~0b,`(J T`kL @T $WLT(NG~<gNDoHD @"@ jB`TF4 @P nTJoHHe="P `H M "@ 8 1UW~0Wb, W`(z8{~xjthpfldhbd``S`P PThXgg~@X(@VHR O &@J (̿T WF֏PE} ֠PWbWH00P_"@֠E} ֠Dc"@J(֠E} bY"@J(֠E} b"@֠E} b"@J(֠E} b"@֠E} `@ @k gD4FAWF0WJ(WL,DBFDTD$X`D81쾣9WL(P 8 1.SWH(y֠E} WJ(dbgL,"@֠E}  HE} P(T(+ ֠THTHTH*TH+ ֠TH_ @ TH+^ @֠THTH*P=&@T=@X(@T5@X(@UHUIקHeAW~xWjtWhpWflWdhWbdW``z{~b` O a~ @T + "P T @ @TF"P=W~" WbW`z {~$h fdb` @E~PO @A + "@!0֠"@*"@ T4d8P=&@W~$Wh WfWdWb W`z(JLN {~J `8 1JN W~zI {~T|PnLlHjDh@f<d8b4`0"$d$-#D  P  p@81g`j,  0H֠\k Fdsh`d=Etc  "j$ d"@ %a~ pa d"@ N$[\ \ AA @Q"@J JQ"@ D @>֠X,c  "1$ d"@ %a~ p( d"@ N$"\ \ AA @"@J  @ ֠X, ,, W~TW|PWnLWlHWjDWh@WfT b` &TDTDT$PW~@Wf`WTJ$@TD֠PI00P D @` P֠g0! D  `WTJ $@ @P` `֠g0! Dd @$P0H $@ ֠ H\ @J֠0& w @J֠0&  @J֠0&  @J֠0&  @J֠0&  @J֠0&  @J֠0&  @֠0& & @֠0& R @֠0&  @J֠0& TTH fQTJ @0TH 8 1.S֠& TJTLfuTN @0H ֠ HTTH fTJ @0TH 8 1.S֠&  @֠0&  @J0TDdLD TH  TD@@LF TH 8 1.S$@ ֠& '& W~ WfWdWbW`z({~ b` TH TXPTFTXTXPFTXPFd >G"@ P 8 1֠Jt"@ P T֠BTF8PPHdd) Id" 8 1J@@"@ h p֠B"@ P 8 1d J֠B<*֠=$֠=)#֠="d ֠="@ P֠B+"@ P֠B"@ P֠B'"@ P֠B"@ P֠BQId00P Dry"@ P֠B"@ P֠B"@ P֠Bt"@ P֠BM"@ P֠B"@ P֠B"@ P֠B"@ P֠B"@ P֠B"@ P֠B"@ P֠B@"@ P֠B@@"@ 8 1h, p֠B8 1J@W~ WbW`z({~$d b` TDX$PN T+ ֠xTT TH T+֠xT֠xTT*#DPTDQHPTaHdF 8 1J`WJQHXe WFW~$$ $W~$$ Wd WbW`z({~$h fdb` 0TX P T|֠e "P֠+ (֠yT|TPQET|TXP TJXTXQH P  THTXTHX`Td`` d (DRFH֠ DPfE}oDR֠DL(\$@"P&`dDQd   dD"PdD/d*L%T ns&@ Po"P"@T|+֠"@T|+֠IT|T|*AGTFW~$Wh WfWdWbW`z({~(f$d b`!D 0  \ 81,  dF TJ TJ  TTDoRP TJTJ  n @ fG}e P @W~(Wf$Wd WbW`z0{~b` 8 1 p @"@v P`8 1 x @"@v P`NE}֠8 1  @"@v P`0W~WbW`z {~(j$h fdb` dP @@(@ 8"1b-"`\0&@k (`*@8 1Ԩ  P 3$@-$@ &֠L$@$@ &@ &@&@8 1ړJ`&@&@ړ$P`Ԩ P @*@ .S"`k &@0& W~(Wj$Wh WfWdWbW`z0{~$d b` dF-  *ns"@ $P @ @ 8 1.S@@$@ 8 1h"p֠8 1.SW~$Wd WbW`z({~@@ ph  W~z {~ b`us  @@ @ h "pW~ WbW`z({~0j,h(f$d b`*  G@ ThTL 8 1Jdpns$@ NG}  TF&8 1ԀTJ DnTF&T "@ ֠@@NE M ?NE ns$@ )!T THT P,PȨ)NE @@"@ 8 1h$p"@ 8 1M֠W~0* ,PȨNE @@"@ 8 1h$p"@ 8 1T֠W~0* M! T 8 1P J8 "@ @@h $p"@ 8 1֠|`"@$PP@"@ @@h $p"@ 8 1k"PTDP@P@֠W~0* @@ h $p"@ 8 1o֠W~0* TH8PQ'W~0* n$@  @@"@ 8 1hD$p֠W~0* "@  TF<$pTDHhFD֠W~0*  h $p+W~0* Wj,Wh(Wf$Wd WbW`z8{~ b`  G@ TL 8 1JPd pT (A@@T ,"@@@"@ h pW~ WbW`z({~ b`  G@ T  8 1JdLpTJ(A@@ @@@ @ h "pW~ WbW`z({~$d b` TD T(T`TTFT(`@@"@ h $pW~$Wd WbW`z({~$d b`$  ns @ "@8 1,PJĀ$"@@@"@8 1֠n  P$`ns @ @@n @ @@"@  h pW~$Wd WbW`z({~$d b` TFT`t&%#T`\`"@ "@  TF< pTDHhFDTF PfG}`R1@RHt "P"@ 8 1=֠W~$$ TDP@P@"@ 8 1@W~$$ Wd WbW`z({~b` T "\l @֠W~" #W~" WbW`z {~b` T "],l @֠W~" #W~" WbW`z {~,h(f$d b`  G@ TL 8 1JdpTF(I00PTPAdTH(dns$@ + "PTDP@P@"PTDP@P@֠dLdT$NE~dTDHQ + @֠b& @* @TDH"@[T$ @eHH "PTDP@P@֠\`T$"@LFqd Dq"PTDP@P@dTFns$@ $0TFTDdPTFFdj"@$PTF$( "@ 8 10֠( TD4TH( @"@ e @"@ 8 10֠( )( W~,Wh(Wf$Wd WbW`z0{~,h(f$d b`( TD&>P  G@ ؾTLD8 1JDd `p @TFeJ00P\"@&@@"@ h $p@"PTDP@P@"@ 8 1TTDG"@  $pTh@@֠mo&D\@@"@ h $p\@"@"@ 8 1g֠m&@@"@ h $p֠m@&@@"@ h $p"@ 8 1|֠m@@"@ h $p)W~,( 8 J78 1  `STH|TH|;8 J7 `STHTH;W~,( Wh(Wf$Wd WbW`z0{~db`$  G@ T  8 1JdLpTTLW~$ TJ$A Wd\` @֠W~$ %W~$ WdWbW`z {~db`  G@ T  8 1JԾdLpT'$JH00PMTJ@TD @W~$ 8 1J ( @  @ 8 1 0֠W~$ %W~$ WdWbW`z {~@f<d8b4`0 T@P#+ T @* @oP8 1T J4TT$,T4,L [oT H$T4,WF$T4 T4,dd8T4,֠P&PT4$`QZ0TPT"qL("P"T $@d"pT DL@kf@F֠"   PT d T$@sBLD@@T<$@TH TT TPRRgD F" W~@WfP  G@ ؾT 08 1J$dLpTF`$ TDT nDus @"PTJd00PTD`W~(TDT(PMTJ@ PTP@P@ @ 8 1\\LqTH2D&@ NEX q\ @ qTH @[TJ$  \`TJ$ @֠eH PTP@P@ns"@ D9P t @"PNE~> T Hf+ @"Pns"@  m8 1ԀPJp֠} m֠} m\`TJ$ @ @ 8 1\ @f+"P ֠~W~(\ @ @ 8 1\֠~W~( @"P @P @ 8 1\ @ nT jW~(T֠} @ T4 RT4 e@  @ 8 1֠a\ @"P @P @ 8 1\֠~W~(TDT(PMTJ@ @f+"P @ T4 RT4 e@  @ 8 1\ PTP@P @֠~W~(TD`% @f+"P %W~(Wf$$ Wd WbW`z0{~Dh@f<d8b4`0  0TX@PnsP 8(1֠P(x8(1@<(x@$J T kL @gFT $WN FT(NG~<f$DHn&@ TH+ ֠THTH*WH$T THTP &@ 9(@$PW~DWh@Wf<$ Wd8Wb4W`0zH{~Dl@j<h8f4d0b,`(  G@ 0TdTL 8 1JdpTF ,J00P@`dL1s"@ PdTDWFPX"@F TD8 1PX=d k8"@֠TF dTDdns&@ dPdoDD"@ 8 1H֠ 1LHL0 @ PL1 P 1("@ "@ 8 1S֠TF],"@l"@`"PTDP@P @֠TFL1"PTDP@P@TH d *xs"@Jd"@֠TF ֠41ns&@  "@ P 18 1֠d"@ LHL0 @ P "@ L1 P 1"@ 8 1"@*P֠TF"@ x"@ 8 1֠TF"@ 8 1֠TF"@ 8 1֠TF-TF W~D, "PTDP@P@W~D, Wl@Wj@@Z_ @@@dD dFDTJFTLkfTN @@ @ 8 1@@֠ " ( @  @ 8 1@C" W~(Wb$W` z0{~8f4d0b,`(Qd TDTfOTJZ_"@ TPHPTTHTTPPqL P H,Z&P"`TDPP `PFHTRTPRD"@DRFkf pF0 "@ 8 1 @ `z֠i `$@("@ "@ 8 1 @ `} `$@ & W~8Wf4Wd0Wb,W`(z@{~(f$d b`&  G@ T  8 1JTdpT"DD/֠@@@@ @ h $p PTP@P@\ @T @   $pTh@@ @ 8 18֠W~(& o\@@ @ h $p\0 @ @ 8 1C֠W~(&  @ h $p'W~(& Wf$Wd WbW`z0{~$h fdb` @U>P 0UHP+ "@֠]"@d]2D$@ HT 2$@ AT LHOW~$2$@" NEW8(@2$@ NEW.(@^mL @ '(@^m @  (@^mL @ &W~$L ^m @ W~$֠W(@LHW~$(@l&P `֠dW~$*"@W~$Wh WfWdWbW`z({~PfLdHbD`@ TD >P 2@ Hk (F"@ PTLL]FD("@| PL &WD & gF$T OHOJ,  L TFHTT֠ LT TD 81, T,J,  & L "PTDP@P@l"@W~PWfLWdHWbDW`@zX{~$d b` T ns"@ #!#@@T PQaaD QQD QT R @@@@$@ h "p֠&$@ h "p @ 8 1.S/W~$Wd " WbW`z({~Dd@b<`8LPG~=H T`$H$$T4 T(T @֠T(@H n DT T $T @T(dnH$D TJ$H(oH8 1Jؾ"`pTH$JH4oR d HXJP"@ ,sT (H,Z P"`"@ 8 1W~DWd@Wb<W`8zH{~b`   TDXPTD4Po@H\֠ d  D\8 1J `W~WbW`z {~b` TF4P o8 1J0 ` D\W~WbW`z {~0b,`(J T`kL @T $WLT(NG~<gNDoHD "@ TF4`Pe@H M W~0Wb, W`(z8{~<|8n4l0j,h(f$d b`D< @tSJDLH eT &$@M"DUH  D UAP$@֠=D$@@ $@*UHP+ &@֠&@*&@  ModLMoNEX֠JD 81, $ D)(@"P֠H%Hk ( `D(FdD81<D$dFJF&WD(@81TJ(@]"PL4NEX (@(@"P"@ 8 1.S$(@|$PLOD(t*  p* ,2T 0VEXX T ֠;T  81p֠(P$`8*1j$NEZ &@"P**`֠](@+ &@&@"P*`(@|"PLd WND$NUH *pgF$FOF Dܸ, FDD@,J,   ` ` D , *pD  oUH81P(PP "` ]ll(@P* W~XWjTWhPWfLWdHWbDW`@z`{~0n,l(j$h fdb`&k&0 PWhL `Upkn%0n&@ dA$@ d&@ a$@ aU0W~0mWf0WdW`0D 0U0UWj$Wb 0U U֠=OD&4! OF$&PU$` p֠ ! OD$֠ ! ֠ %OF%5 OD&"/U&P$` p֠2UgB*  $ ֠3ETFD'OH%    U $` p W~TW|PWnLWlHWjDWh@Wf P݇? P8 1݇CJ!(8 1݇@Ja# @k LM @8 1݇(J!`8 1s]J!vW~WlWjWhWfWdWb|W`xz{~W~z{VE!5~PE!dVKE!NMH$-W~PI~xQWN4WH$WF0Q WH$WF,QWH$WF(QWH$WJ(WL,WD8WF<NWN@DFWDDNЇWN0D I~h,J$ $W~PzX{~0f,d(b$`  $@44 0 *44$@ $@4VMe $@4VMe 44$@ 44$@ $@4 44$@ $@4VMe $@4 &`44$@ $@44  辣VIe @ fb`8 1J!8 1q!$pW~0Wf,Wd(Wb$W` z8NE# KS00P81֠0"81֠0" 81֠0"081֠0"@81֠0"\81֠0"h81֠0"|81֠0"81֠0"81֠0"81֠0"81֠0"81֠0"81֠0"81֠0#81֠0#(81֠0#481'T,00P81֠a#@81֠a#P81֠a#\81֠a#l81֠a#81֠a#81֠a#81֠a#81@P@VG!@I{~`44 @ VI `44 @ VI  ` @4  @4 @4 @4 @4 @4  W~W`z{~,l(j$h fdb`44"@ P@?W~,44"@ "@44 `"@44 @Vge 辣 &@(@ * "@VI "`"@4  "@4VMe "@4 ֠W~,  VI "`"@4  W~,Wl(Wj$Wh WfWdWbW`z0{~`@pVI W~z{~b`T  LF-b֠LD LD bW~" WbW`z {~b`T  LF-b֠6LD LD bW~" WbW`z QD QD ֠pQD ֠g ֠g QD QF00QDDؙ֠QDQD b b I֠ؕ  QFؙ֠F QDD{~8n4l0j,h(f$d b`  pLWhP~ `P]z$ " @8 1vJ%  @֠ &8 1vJ%  @֠ &8 1vJ%  @֠ &8 1vJ% U D,@*P ֠+ L  L(+,@*P LJ  L   @UWH0L  L) ,@*PWN&`L,  L] @ W~8Wn4Wl0Wj,Wh(Wf$Wd WbW`z@{~db`` LF  }  } bLDM$@bM$@ P ` W~Wd" WbW`z {~$h fdb` 0 @"$&!W0T &@bT֠ W~$Wh WfWdWbW`z({~8n4l0j,h(f$d b`, #  0 d @J ~,81%L  9 P"`L{(b4WH֠ٷL L   P+ WD P+WB  ֠L81&& XWF00L5" 6$@J dHJ  WDa8 1&WJ *PJ֠LLL},LL|W~8LL{W~8LLW~8֠Wn4, @"@k (`\ @k L:#p!P" & $@$P L( L@LL@$P)J֠k ` 6LL+ #L$@L#,L  Lx& " [RD$@L`F F$@LF$@8 JQ؜*` p W,֠ڸLLL].LLJ L$@WF  D *@ PAWN ֠LD8 JQ؜*`N LL,LL[W~8jWH(Pd WN.`W~8819&P,W~8Wn4, Wl0Wj,Wh(Wf$Wd WbW`z@{~$h fdb` 0 @ T$]#WTJ&@ ֠? bW~$Wh WfWdWbW`z({~ThPfLdHbD`@( 0'& J( (( 8"1@,b&TL    Hk "@9$P&`Lx& $ [RD0 @ Lb,F0 F @ L  F @8 J؜L"pW(֠ۗLL  L].L LJ4  L   @WF4D4H"PsWN4 ֠LD8 J؜LN,L  L,OF L  L[OF J WH( @,G"D@֠( W~TWhPWfLWdHWbDW`@zX{~b` T  8 1.S&j@W~"@ 8 1-&nە@"PW~WbW`z {~ fdb`K " A @D "&K"D, P$Abd DAbW~ WfWdWbW`z({p~fdb|`x 0%W0"'JT d @ c&@ه PLc819&xPc@W~WfWdWb|W`xz{p~fdb|`x$T&]#WT`J d @ G @J819&PbW~WfWdWb|W`xz{~81&8 1J&  81&8 1J&   81&8 1J& 0W~z{p~fdb|`x&  J  d*W~& 8 1,HJ'#W~& 819' P߭ @819' P81Є'L 8 1b"@J'X֠Gc819'\ PO$@&W~& WfWdWb|W`xz@ {~NE# VE"@ @W~z@ {~NE# VE"@ @W~z{~db` a# @ P "P$PW~WdWbW`z {~db`R" @0E#T+ ֠`T P$`TT*"@֠nW~ "@$`W~WdWbW`z {  ~ W PG0W~ z{~$h fdb` @ 0"$&!W,TbI#هT &`0b W~$Wh WfWdWb W`z(I$\A$\{~ @PW~z{~@` W~z{~,h(f$d b`( R $@0TH@TTL LD ֠WT &TH7 $TD,T֠$DTD$  LJ TH$G@$TD( LJ TH(G֠!@(P,TDߐTDO a~ @TFNEX"@֠OL D ֠O$P&`֠O@"@L D 9$P&`81'$PP= @( W~,Wh(Wf$Wd WbW`z0{~,h(f$d b` L  02D@  VEXTNKXWL ݱ~ @`L ~ @FTHPrLL FL HT TH 8 1.S'7TD#W~,LLD`TH L  FTHT d dnTFd D dFW~,Wh(Wf$$ Wd WbW`z0{~db` L$ I LIT  T TJ(T @"@ P ֠ _ `T TJ$@"@ P ֠ _ `81' PW~$ WdWbW`z {~b` M  !"@M (!W~Wb W`z {~<h8f4d0b,`(( TD,  0D @81, '`,"E]c  ,@T֠c T T$T!  LJ $  TD,LJ P$ 1d2T4T %T( LJ (  TD,LJ P(DJVG~ dFDT, @, L ֠LH ֠  LH VM$L  LH 81'"PW~<( Wh8Wf4Wd0Wb,W`(z@Xd00P81֠'81֠( 81֠($81֠(<81֠(T81(l_Xx00P81֠f(p81֠f(|81֠f(81֠f(81֠f(81֠f(81֠f)881֠f)81֠f)81֠f)81֠f*881֠f*L81֠f*\81֠f*x81֠f*81֠f*81֠f*81֠f*81֠f+81֠f+$81֠f+081֠f+T81+t{~l`h@ DF"D .F$8D(FF,TD0]F4lOD8yF<с@D@0VE$` a~ @֠ P   " A$pA$E$`VG$pVE$d֠VE$h818 1H+|J+E~֠ E$dVE$h'VE$l N   0P0PVI$D0G$    D  VI$81,+E~֠ E$hVE$lVG$p DDDHI$ VELDDPVI$ 0VI$ E$lVG$pVE$|VE$s@T@XVE$G~0@VE$IE$֠E$@ϩDA$p֠" A @0N0DVI~ PpQK$tG$xߛ0G$|VM$ ֠VI~k`bVG$| VE$H` cVO~ +@bVG~ OD`@VG$|!VE$֠uE$E$pA$`0VI$ 'VI$z A$l 8 1+.SVI~$VI~A$h֠A$d֠@T@X@ZVI$ VK$pNTVE~@PbPVG$pPG$pW~lW`hzp{~(f$d b` 0  @"RD 0 8$1,+$p`f@@ dD O a~ @VI$"P*$``P= @W~(Wf$Wd " WbW`z0{~` T @ ֠ L T$G L T(G֠$(NEX"T,P,ߐ L T,P$z L T,P(z @ 8 1.S+W~W`z{~b` O c~"@T VI$+ P VI$ VI$+ @P="@W~WbW`z {~db`   " 81+ PT$NEX֠q%T$T(P"PT(W~$ Q֠j%T,W~P$"PT,P("P֠sW~$ W~$ WdWbW`z {~db`    ֠T$ T$ TJ$TD(TJ$P)P`TJ$@ W~T(WdQH)P `W~WdWbW`z {~` pQ  F Q֠!Q֠! xP֠W~ Q&!I 2֠W~ D ֠! I !֠!2I @֠W~ I &W~ W`z{p~ljhf|dxbt`pD @ 0 ( `81, +@XM 2D@ VEXXNEX[ ,  @,"P THHTHT8 m_(Pn}WHT WHTNKfu$BP~ $"@DM LOLDHX LM WHX2D@  VEXTNKXWM ݱWHXM WHXL mWHT WHTTJdL dNnWHTn֠$PWDX~ ("@LD2DM F VE֠dD UU F HM OLHX LM WHXPmWHT TFWHT n8 ֠WHTTJdL dNn8WHTn  qFWHTFG{PI{֠$FE|2=WDXc{"@D\;="@ WF\P P,PH\WF\"J`LdF(fE|0uWHTD&f$&@b4"PdDd $`ɵWN`D6WDHgFF &@"Pd$`ɵWNdD6gDFWDXWFTU(W~U $@ WlPQJnPW~Wl* WjWhWf|WdxWbtW`pz{~b` W~TzTpwT8"1b+ .S"` @ .S"`W~WbW`z X00P81֠+81֠+81֠+81֠+81֠+81+t ֠81֠+81֠+81֠+81֠,81+t{x~b|`x T$ H8 1J,81"`,$T $HT( T,H8 1J,81"`,(T (HT, W~H8 1J,81"`,,'T ,HW~Wb|W`xz{p~fdb|`x H 08 1 , P81"`,4H&PH P81"`,<H$$PH P81"`,D$H$PuTHW~WfWdWb|W`xz{x~db|`x H 8"1b,"P81 `,4H$PH"P81 `,PHHW~WdWb|W`xz{~`  @W~ @PW~W`z{~db` a~O @AVI$+ ֠xVI$VI$$@VI$VI$*PAID P= @W~WdWbW`z {~4`0  W~4Hk R @JW~4W`0z8{~I I 2D0W~zGX00P81֠,X81֠,d81֠,p81֠,x81֠,81֠,81֠,81֠,81֠,81֠,81֠,81֠,81֠,81֠,81֠,81֠,81+x֠(֠(81֠*,81֠*-81֠*- 81֠*-81+x{ P@Q~pQFLYH00PQD$CW~H  0/@ )@ !@ ֠|IJ ֠{ @    @ ֠{ ֠{ @ IJ `@W~z@{~2D VE֠W~zVGVE֠W~zVEW~z@{~2D  VIW~֠W~z{~(j$h fdb` 81- @$P 0"TT*NEX֠+ T$֠"@T("@, P ,  ֠+81T,-<$P"@, P ,  VG~Fd D 81-t$PW~(* Wj$Wh WfWdWbW`z0{~`Q (W~~ @TdL FrPTW~W`z {~b` O a~ @VI$+ ֠`VI$VI$Q VI$Q(VI$VI$VI$*@I P= @W~WbW`z {p~db` `xM @ Z @ ׂI~ Pw @8 1 -& @ $E$& @ %lE$l"@$PNGf^"c~fG]81-J dH< l@81-J dH< l@81-J d H< E$E$mW~WdWbW`z{~ 8 1.S-W~z{~`8 J8 1 - `?VI$A$8 J `?VI$mA$קI~W~W`z{~db` O a~ @VI$+ !֠VI$VI$*TVI$P="@W~WdWb W`z {~(f$d b`D 0 ( 8$1,-$p @,&P (8"1b-̾"@ P P$`*VI$þ"@ P81-&PW~(Wf$Wd WbW`z0{~b` TFVI$֠" + ֠VI$TDVI$T  LFTJ ALF, LFLVI$֠ VI$*TW~WbW`z {~4l0j,h(f$d b`$ 0+ `P֠(EAT LT Lh   P ((@,@&@EFW~4*&@W~4Wl0Wj,Wh(Wf$$ Wd WbW`z8{~ @0pPVI$`W~z{~0j,h(f$d b` & + VI$ P֠%(TD$VI$LhTH  VI$ P(  (,E @TFTD( PTF(` VI$ VI$*T W~0Wj,Wh(& Wf$Wd WbW`z8{~RW~z{X~|nljhfdb`(81.8$1. pHAH0HF(HN)HP*HF+N,HP-F.8$1.< D-b0"@8 1J.%N(O a~ @VI$+ #`֠VI$.VI$`d @k R"@ Pah0 @d8 1J.8 1.0TD$pDqJ( `$0 @dIh08 1J.,`TD$pD&.@&Ih0d P8 1TF8 1J.4.0 81֠.L81֠.T81֠.\81.`D$pqJ(*` $dTH8 1Mh0J.4 81֠.LD81֠.TD81֠.\D81.`D @,`$p&.@Ih0d P8 1J.dWFd8 1VY\.0F֠ ddLdWDt$pD qJ(*` VY`dIh0WFd8 1J.dF֠$dd81.0Dd,`WDt$pD &.@Ih0d P8 1J.WFh8 1VYd.0F֠?ddLdWDx$pD qJ(*` VYhdIh0WFh8 1J.F֠Ydd81.0Dd,`WDx$pD &.@$pdddd ah0 @8 1J.8 1.0WF|WDpFD$qJ( `@,`$pdddd Ih08 1J.WF|WDpFD$&.@WDlah0 @8 1J.8 1.0$pDqJ( `@ (Ih08 1J.,`WDl$pD&.@(VI$VI$*ALD P=E~@W~$ah0 @8 1J/8 1.0Rk ֡  TH@.RR ,֡ THaR * ` THTD aP,pW~0TD PRTH@ `TH W~0Wn,Wl(Wj$Wh WfWdWbW`z8{~` @ ֡9LT T  W~W`z{~` T   W~W`z{~` T$ T  ֡eL  LT ֡sW~ W~W`z{~`  @ PTDP߈0TDT P TD8 ,0W~W`z{~`  @ PTDT P TD8 ,0W~W`z{~db`"  @ P%Z\T TDT@PPT TD LP0L0P T@ P ,0PH! "֡"֡"T"PW~WdWbW`z {~b` TDDVG%W~WbW`z {~b` TH  @"P9 @ @a @ @ @"P{ @ @ @ 8 1.S3FW~WbW`z {~$d b` VG%<@@Q"P@ D7֡ `THT $``P pVI%*`W~W|Wn|WlxWjtWhpWflWdhWbdW``z{~` LP0ZE H T$ } @JWFW~֡ $ W~TP]s$W~W`z {H~` T PGJ PjPHj'P PiC@ P@0bT4FPT8@ @Q!00V^488T88T4T 8aT8 L< =L= < =  ֡ \ = > <  < >T4֠ >W~W`z{~PFPZAD0H H @W~ z{~P Z@F0a H`H@I֡ W~zW~z{~$h fdb` 813 P @ VG%<0PP9$`(pO a%h @ &@THSdz$PTFH"@&P(`֡ ev֡ e $PP= @W~$Wh WfWdWbW`z({~ VE%<@ PP Pf+W~ z{~(f$d bVE%<`HP VG%< PLVG%< PLWFW~(WDWf$O a%h @VG%<"PL!0dPLVE%<@0 PPb @bdVE%<@0"e$"VE%<@0 PPb @bdVE%<@0"dVE%<@0 PPb3 @bdVE%<@0"e"VE%<@0 PPb O @bdVE%<@0"e"VE%<@0 PPb5 @bdVE%<@0"e"VE%<@0 PP b @TLb @bdVE%<@0"e"VE%<@0 PPbg @bdVE%<@0"e"VE%<@0 PP bT\b @bdVE%<@0"dVG%<VE%<@0 PP bTTbT bdVE%<@0VG%<H֡ P=&@W~(Wf$Wd WbW`z0VG%<PL{~8n4l0j,h(f$d b` pU+ *@֡qT]^00PL VE%<LHLLT T  .PTT .P֡S$@ $@ LT T  .PTT .P$@ 8 1֡_3fT @T .p$@ 8 1֡_3vTT T"THHTDH @ .p1"@dzTHH&P֡$@ Sev֡THHe &PTHHf+ $@  @ T .p@"@$@ 8 1֡_3L TTT.p֡$@ TTTT nD$@ 8 1֡_3L VE%<LHT.P$@ 8 1֡_3L VE%<LH*@֡qT.P$@ 8 1֡_3T(U"L+ T$"@T "@8 &PP$@ 8 1֡_38 &PP L,$@ 8 1֡_3L,T (@.P T ."@D&P 8 1 3 pT,(P* `>֡T+ "@"@8 &PPT,+"@T,8 1+  3"@"@8 (PH+"@$@ (@.P $@  `e.S+*@֡q$@ 8 1.S3m+*@**@ TW~8Wn4Wl0Wj,Wh(Wf$Wd WbW`z@Q$F  F {~ fdb` T0"@W~ L"@֡`$&P `$"@&P W~ WfWdWbW`z({~(j$h fdb`  'f P;W~(THL @*P Ld @ ",04 H$U @= @ @֡U$ @= @W~( @*P W~(Wj$Wh WfWdWbW`z0{~0j,h(f$d b` T<TT8VE%<PlPJ\4FqW~0@E@*hP=a%h @VE%<PLF^L*D @ O @(2j֡o2֡o2#TDd2  TDP=a%h @VG%<PL@\2^L* @ O @TDDET  P=a%h @T@TDO @T  D8 #4V_H  4W~0Wj,Wh(Wf$Wd WbW`z8{~,l(j$h fdb`  Wh@WlD 0e TT"mW~,THGL @,P L5d9 @ @a @ @ @ $F("&( @ @ @5 @ @ @ @֡$ d a @G"&( 5 @ @DW~, @,P W~,Wl(Wj$Wh WfWdWbW`z0{~\dXbT`P TTEW~\T\AWdXTT$Q"VG%8 FPTVE% @T @LD0 D0W~WbW`z {~4l0j,h(f$d b`>D @ `  8$1M,4$$p$@& APD &P#ZAe&&" 'D#LD*P$`*UH@DUF,@@,@M E\H,PD,PUD$`D*UH f&$@ jDUL+ ֡pUL*UHuULUL*P$`W~4Wl0* Wj,Wh(Wf$Wd WbW`z8{~ fdb`+  0&@8 "PdZW~ T + T *DC"PT +T *@TTD,,TF  TDDD@,֡@ @D 8$14$$`?T  $`?T˸+&@@,"@T @ @D @ .S$`֡@,@08 T H+T @,@0W~ WfWdWbW`z({~(f$d b`VE%< 0TT`@T"BW~("@ڈJ `T L+ T WH `UTb֡"@ bk`"@ "@ ֡,d$ bk`d$TH`@H YD_F #aDJH$@ PW~(Wf$Wd WbW`z0 VE%<@ PP+VE%<l VE%<@@QP<fO%fM%fK%    8[   {~D|@n<l8j4h0f,d(b$` `  @T& WnX6Wb\&@*@TG~eA~*@ ` #] e bx$@,P".p."@ / @ |e e De Fe Le .e"@e e De Fe ze @ $(ee, @ 0W~DW|@Wn gD:" dgJ6h00P֡#֡#֡#  b0 hP  `֡# F 0֡#] b hP b0 h,  `֡#D 0֡# b hP0֡# b h,D 0֡# b h0֡# b gD b0֡# h 0֡# b hP 0֡# b h b0 ht  `֡#$ @PT\`TXDT TF*Rd NW~W`z {~`  d$d T\`TXDT TF*Rd NW~W`z aa a E @0a PaF ,aDh00P֡$ aF֡$ aF aD aH(aD,֡$aF aH(aD,aF.{~b` 4B@<$8(gd b `d@d0 b `*d`b` b `0 ,.d!Adgd b 0b`0` d@Pb 0@` b  ,`d@00@. b ` 0 *2H6 G Li00P֡$ ֡$  ֡$   gd Kd@b @ ba `0֡$  d d ֡$ d 0 dd 0  ,.2d DW~Wbd W~  W~֡$W~Wb 8 (W~WbW`z {~thpfldhbd`` ` @ 0 k @ JdF ! fhdlhp+]H` @!!֡%zW~t!@@ gD sW~t"@  b &` gD"@֡%zW~t!gD \W~t"@  b &` gD"@֡%zW~t>!!!! !)@@ "@ ֡%eLgD) !  ! ֡%zW~t ! ֡%zW~t ! ֡%zW~t ! @@ "@ LgD&N\D\֡%zW~t"@ ֡%zBW~t"@ LgD&N\D\W~tWhpWflWdhWbdW``zx{~d|`n\lXjThPfLdHbD`@ d ~, ld_&`gHdD b `dF8I piH@00P @(JL8֡%gD8&` @) JL8֡%gD8&` @)JL8gD8&`* bFDldh b֡% `@"j:h<&`d@< @'*P(`gF< J$l,@@bgD@DgD:2"  #@< @T Do<p$d (.@<p+]&@,P@!!֡&5W~d!֡&4  ֡&5BW~d!@!@@!@!@ @!@!!!!֡&5W~dBW~d W~dW|`Wn\WlXWjTWhPWfLWdHWbDW`@zh{~db` dD( @ ֡&o\L(d\`H$ P`dD(d D(dL( @Pb$JHJPdFW~dF(W~WdWbW`z {~&@DLW~ z {~db`  d#@PYA d(d( d(  Dd(D $Pd(@`@b$H@d( (W~WdWbW`z {~LD@P&LNW~z PaF(aD,QDDaF(aFQDDaF(QFD` ~D6֡&F QDDaF(`DDF(H6!D {~PD:~F6aF Ni\00PaD4aF2D4 @D aF(aD,aF7W~aF0+D ֡'HW~aF'W~֡'6aD( aF֡'DaD0F ֡'FD@6& @֡'HW~aD0֡'G@:D0W~z{~b` @ d: d:d6& d:d6֡'W~ Dd d:d>0@dD>d:֡'>\>>d:@֡'>d:0d:W~WbW`z {~,h(f$d b` @  @&'L(@J gD֡'W~,dddD DddW~,Wh(Wf$Wd WbW`z0{~ fdb` d$A0֡(:8d(d, d,6֡( ~~6d(TDd(֡(W~ d(TDd(#gHd @ b `&P6`b!dD b `6֡( 0b(`D(6:8W~ WfWdWbW`z({~b` d8 ' @d:֡(W~@d:d6 Dd (dF dF֡(/@d:Bd֡*>  &@6 `d- ֡*>&@6 `֡*?(d(!֡*?d(!&@6 `&@H$ P"` @@Pbd(JH ($d(PW~ WfWdWbW`z( YK 0 {WF(~WD,aDaFQaP`Pa*m\W~z{~$d b` TF0 $i00P:TH\֡*$TH;OTH\֡*$TH@TH\֡*$TH֡1wW~W~a@a>aB d ֡1w W~ W~W`z{~db`  L"$@ @Da"$?W~L 9d a ֡1W~Lpd0   ֡1P @pW~ W~0bF `0``0bF W~WdWbW`z {~hndl`j\hXfTdPbL`H(  p P`֡1&$dF>TD8PF>H81I"@'dHTD8\  "@ PTL8dF>LTD8P1|F>N8  ( W~hd jl"@/J.p@( W~hWndWl`Wj\WhXWfTWdPWbLW`Hzp{~db`WD8    dWL0"@5WL0"@1WN4$PW~WdWb W`z {~db`a d ) pdP@c! d*@0b0֡2z0 ~d  b d00b@ d*d Ad# aF IHJ2"0֡2@ bd@֡2W~#@$ P"` @@PbdJ $dPTVkL8 W~W~WdWbW`z {~`a d dd +֡2W~p d b `0HJd  PbJ,d  PTVkP8 W~W~W`z{~db` Q4 Q@"a aW~4z֡3*W~ @a W~WdWbW`z {~$h fdb`&  T`4@JTp!c$֡3` dH< ! ֡3`dH<E&0dH*X dH<P0PN Lc 0D< dD@dF> dD< & dF@dD>9 0TH4dF>dD<Q F>D< J4 dD@dF>,dF<J T`4@!?J֡3"" J!W~$$`( $ &dF>TH4Q ֡3F>J4dF<FPgF>gD0E4  W~(Wf$Wd WbW`z0{~PjLhHfDd@b<`8&@0 d@d> P @e 0d ֡6L@d@ d ֡6QW~PdH\  d&d@ "`00@d  @$P4&`N0֡6K5$P&`0 0P`&d@d>  W~PWjLWhHWfDWd@Wb<W`8zX{~db`    dF&dD W~W~dD< dF8 6"@ dF8 ֡6W~dF8  DHF8dD( H( dH(dJHDHH(dD&J*dF(D&dD8$  ^H8$J: ?@6@F4%֡6\D&W~$֡6\D&W~R'P֡6\D&W~ ֡6\D&W~֡6֡6֡6֡6dDP֡6DP֡6@P\D&\D&W~WdWbW`z {~aPa,~7p֡7LW~~֡7Y <Y <!K!D )J@aHaHaP HLaH0H "$(֡7? * aP֡7?L)J@8:~, <Pa (W~za&&p`@P֡7m&Y&pb (a ) ) 8Y&J&aP {~bA$D-` dJd \&W~d֡7 \&W~d (֡7JJ @֡8"P 0 @֡8"P dJk00Pd @ JJ @֡8"P d @ L֡7JJ @֡8"P @0Ȁ @J7P"P ֡8Ld( ֡8J8"@@?dLL9lL00P֡8J֡8J֡8J֡8J֡8J֡8 J֡8&dd @$DL(""dJ֡8 VK&8"@֡8L֡8+VK&$F<0dk  k`0`dJ֡8 V X$D֡8IZZ$F<0dk  k`0`T V X`)dJd֡8(@$Hkh@dV kxY b `0֡8}$D\$D ֡8Z$D< dk `dJT֡8J$DdJ֡8J$Dd$b?(֡8J @J @7P d\&dJ)֡8J @"P 7P\&W~WbW`z P!H A$!D d@!F0b@!D @!~ b m4 `2$ @0b0`"$" @! bDPaF!P2$ "!֡8"D {~` d2 @PA \8Gd8֡9 LH 8F? H֡9 88LHdF bP HF0)W~d 2! FTD H_֡9> H@0~: Hd::  )T_D H2֡9> H HW~W`z{~b` JJ`J @ _DTJ \F| @  _"D~H~ _TJ  \DDE dD4 dD2 dD4 JD@4PD6dD4 D4 dD68"@dD60D6֡9PD66W~@4W~WbW`z {~b` \@TTd>`0>0T>8 T2 k $֡:6_ @:"PTd2(  d2: ֡:7Td2 @d<< ST8:_T ֡:7T֡:6< 2; @"P9C @Pd2֡: d2 2@_T ֡:7T dF; @"P9C @P֡:7T \ F LHDP0b@ HTD H__T <֡:?T_ |TW~WbW`z {~` Td>`֡:c0>IdB 3BdBIr \0 T_#!PT_ \>W~8 ]>W~W`z{~db`  k 0E&G&@P6@8 ֡:@8 T>W~WdWbW`z {~db` @ QFWD0X kP`bT$@\@TT`TW~WdWbW`z {~` @P@P  \   YT0 + "T\3!@d 2!D \  !D2֡; d2)D2d2W~W`z {~b` AT 8\W~EW`bAa@ Wbz {~db`   k xG'@ 0PLl$8"<@H Bbhfd I PW~WdWbW`z {~IW~z{~$h fdb`(  \D 0`\d`bTJ@b,X@dddD0d@@$pT&Tt\ kT`b֡;TT; @@TT_ \d\d\hdfDW~$Wh WfWdWbW`z({~Q PQLQDD  PBQD LQT`֡;QPPPW~zYdQLL{~ b`VE'  ֡< E'\@IE'@\@Ir IQ!L  _D\8 TT#!D_J_dBB\B TT_ VE'"P\B BW~ WbW`z({~;` TL0LW~W`z{~` ;@ TL0LW~W`z{~` \D  ; @W~a @TW~W`z{~b` T * @ = "PJ>a @TW~WbW`z {~` T @ <= > @P>a @PTW~W`zQ0b # @!KP  # {~Q>W~z{~Q>W~z{~` > ` TW~W`z{~` > ` TW~W`z{~ b` ? J @TP֡>M>WJ"`W~ WbW`z(Q 0aQ4Q44{~(f$d b`  0XfVE'dX?=E'?@J&`_J @>_LdIP$`  _J\DPTJ_@R@P@W~(Wf$Wd WbW`z0{~`  T 0>P @>a @PW~W`zQQ0 Q  Q D {~ fdb` 0TAIT I`@I}T W~ aWf W`bAa#aeWd@ Wbz({~b` T, d"L֡? "  (+\ " ,D( ֡?D@L(T,@b (,W~WbW`z {~(f$d b`  TD '>"@JT b֡?6WF TF W~(Wf$Wd WbW`z0  {~(b$`  DJL T 4"_]d<"PT@ TD @T8@4?a <"P֡?f@d<T40b 4W~(Wb$ W` z0@PoLD Po\D ol`FPQD D<48 @{~` d < k`bd < k`bW~W`z{~b`  P+b `H+"P `W~WbW`z 8 p|yE, p$Q h!p P`bPp4QF `p<  G,0` P~8n` d@ LXPhlX*dd`'  (  H \X p\  Z`pT`adpDp\Q `&2 fxzQ\Qh `  pd `  {~db`   k Ace?"h @W~WdWbW`z {~ fdb`  0& TT\$Pd\TllTpdFv @\bd\\ TL\TLT P\ X^JT`'TX#_T Th T _T ֡@_T ֡@_T ֡@W~ WfWdWbW`z({~m3` @JmkL pd TT֡@Td   @^Z`Td   @^Z`TT>>TgDTgDW~W`z 4@@ taD 0 #!D{~ b` TXdvTX@X"  D x qThq\v 0b X0X_N𢾡@@ TX #^T BTXaFDT XaFHFFTXaJHT XaFLFJd\ TX֡AB\TX^Z & P'TX\NXH@Cᾡ@@ W~ WbW`z({~b` TD|8#! PD0b ##  DP 0b ## J֡AcDJ_TH@PW~WbW`z {~@` \@a\\  qTh  b `֡AW~W`z{~@` \? @a\\ dX֡A \d֡B a\P ޘ_T ֡Bd\ a_T ֡B\dd Thq  b ` _T ֡BW~W`z{~@` \\ \ v q֡BA|Thd`  b XT|`0 |?֡BAAM @Thq  b ` NTXk  W~W`z{~@` d  Thq  b `W~W`z{~@` \ `T @blx@T ddaH 0֡BpLdW~W`z{~b@` T`\ T0b0X \ \ @dF֡BF\ @W~WbW`z {~` Tq P@08 ppW~W`zQ Qaa@Pap 0 0$5 #a # @PS@A"SS0b0#b0#` 00 @ DPLP N!b  "jg d b_ ZW֡Cm"D# d " ֡C3""֡C3"85֡ClD" "֡CK"  d ֡Cm d ֡Cm aaa  a"$"{~ bm3` @JmkL"pdF TFDTD֡CFTHdL  @^Z`THdL  @^Z`TFDTD>F>DTFgDTHgDT`\ T b X \ \ @֡ClC @"PTF\H `֡C@Cp\J `dDȄDTH"`oQl PW~ WbW`z({~C}`  W~o @W~W`zQQQ0$e # # 0 Q QQQ DP!0b # # @֡DȄ@`)!@Pb [SX  K@ 0 0֡Dv pP  `S X P00 @ SapSN0XP  @ S0 a֡Dv pN   {~db` WD0 _d6 k D $ $JP,E9lDPTD8194<i $D |$hr9&֡DI4 @$JW~WdWbW`z {~I=VIW~z{~$h fdb`(  \D 0\\ TJ8194pTJ\\L,@ddD0@@$T& \ kT`b֡DTE @@T_ \\\dDW~$Wh WfWdWbW`z({~Q Q|QDD QF |Q`֡E@QPPW~z{~` T| JE @T||W~W`z{~b` TDP$ 5d#$  DPE0FP`jTD|`nD|W~WbW`z {~` T|dTT P@b0   4$ #Ed # `` b q dj P` 0 lnd l @ jE@PPT||W~W`z{~` F2d XLEWJ @T||W~W`z {~` F2 LEWJ @T||W~W`z {~`F J @TP֡E|F2gJLEWJ @W~W`z Q aQ Q Q  QF|{~,d(b$` \ VE1\ IE1\VI^M1\r"8 1!DJ4d"@I J$`_J"@F_L_THP"@W~,Wd(Wb$W` z0YVQP@PatD  4d u  aZbYdYfp 0a Z 0 p# YVp#aXʰ a\PYV ax"an0 0   bq `xavΰ av n@d"R!J p00  t "Y VvanG İ԰Q L b XQ H0FP{~ fdb` 0TpA IT`IUp@IrTpa !aW~ WfEW`#abAa WdWbz({~b` T dL֡F  +\  D ֡FD@LT@b W~WbW`z {~,h(f$d b` @" \VD 'F$@J ֡GWD\V@0b"W~,Wh(Wf$Wd WbW`z0{~e` @JfL pdX TPXTT֡G6PTPd Z ^Z`TTd Z ^Z` TPXTTPTTPgDTTgDW~W`z @@4@YDt @C!H{~ b` TdTGDX" !D F : ظ_\RGD@  yT^ #BTaFDT aFHFFTaJHT aFLFJd T֡GT^Z & P'TNH@CᾡGD@ W~ WbW`z({~` T 8@S!@P\@b ##  0 DP@b ## 0DJ_T@PW~W`z{~GR` \@a\\  ֡GW~W`z{~GR` \? @a\\ dX֡H \d֡HI a\P ޘ_T ֡HJd\ _T ֡HJ\dd  x_T ֡HJW~W`z{~GR` \ \ \ ֡HdT@ @0 ?֡HG @ZTk NW~W`z{~G ` d W~W`z{~G ` \( `T @be6@T dd(aH 0(֡HeT W~W`z{~bG ` T`\ T0b0X \ \ @TF֡HF\ @W~WbW`z {~` Tr P@08`ЙW~W`z  {~(b$`  DJL ""PT 4G;`_]d<`T4T8 T@ 4 4 @I@a <"P֡I/W~(Wb$W` z04 < @8{~b`  P+b `H+"P `W~WbW`z @s4@b@Ywh@b@Y@xT@b@Y@r4@b@Yw8@b@Y@x,@b@Y @_   @  {~`  kT W~W`zy{~b` TT IT ֡I@00T _DP DIT W~WbW`z {~ M+P`bW~z{~ 8 1.S4"W~z{~$D 81, 40֡J W~z {~pbl`h LLPd\[#y00PK @J@MW~p֡KK @J@B֡KK @J@&֡KK @J@.֡KK @J\@ "֡KW~p" ֡KK @J\@ ֡J֡J ֡KK @Jd@0 \ \֡J"ǾK @Jd@\ \֡J"ǾK @Jd@\0"Lj\"֡KW~p" K @J@d  \d   d  ֡Kd ֡Kd ֡KK @J@d \d  td [ ֡K d :֡KkK @J@Jd֡Kkd M<d 4"֡KK @J@$d  \d  d0 \"֡K֡KK @J@d  \  d  W~p֡Kd0 \"֡KW~p" WblW`hzx{~b`L    W~K"@ P W~K"@ P W~WbW`z QPY V z05 pQHQL QPQT0H P @0P0P ` QHQPH @ P d  @ P0dQPYD V z0F* QN@QPD 0P0P `  P@ d  P@0d  QPY R PE` ` R  P` ` Vz Ec0@ ] DY TP0b zHH@  `J 00` PDP0@d ;P00(  ֡L֡L  P֡L0DD  P֡L0P1F `  {~(|$h fdb`;  \ @ k Xxk X@!b  E @f&Ph"`@ a\ @R\԰@R԰\ xp(` zT &YP P0P aHbaHbZ x0 !YDְJ=W~(W|$Wh WfWdWbW`z0{~` 8 1-44MQh8W~ W`z{~` TNTQ @ 8 1.S4SW~W`zQ{~֡MsW~zW~z{~b`E<   I<,P I<, P @I<,"P W~WbW`z {~P@E<,I W~z{~ VG<GP?GN;@P W~ ֡Mz(NPWD@NpD֡MW~ z(Az(PR) P`W~ z({~VG<W~O W~z {~`0 8 1-4 M @W~ W`z{~M` fE<8 ֡N6,8 I,fE<(W~W`z{~M` 8 I,fG<(W~W`z{~ 8 1.S4=W~zQ !FfE<JD֡N6 8 I,Q(8 Q,{~pQQ8 JH,Q  N|  ֡NyW~zQ$8 ,I#@  N| ֡NyW~z8 ,W~zQQ ֡NQ  !D@Pd  fE<8 Q,֡N  ֡N  8 ,fG<8 Q,{~ b` WR@ NG<GH? GL;ATPNP`֡N HROP THROTP֡NPPp@!fE<zx00P֡Nz{P @֡NTzP @TM֡OW~ zP @TN W~ WbW`z({~b` NE< T` L 8 1,J4 ֡O;@8 1,J4 ֡O;   L  ֡O9 A THMz価PD"@W~WbW`z {~b`  "@ 0  "@ 0 W~WbW`z {~ fdb`      @Wf8OI  OI"POI$POI&PW~ WfWdWb W`z({~$h fdb`  @(@0 % fb `ەH(PW~$Wh WfWdWbW`z(   {~0 W~z{~4l0j,h(f$d b` 0$  @`W`L OGjK @TT DT "@O_TJ a"@(PONO< ֡OE"@OP E"@,PONO< ֡O O@P  W~4Wl0Wj,Wh(Wf$Wd WbW`z8{~$h fdb` $  @O 0@OIT "@OIT OIT  OIT  ە"@&P&@֡P3   W~$Wh WfWdWbW`z(I @GFP @  I!0 {~ fdb` $        P PONO< ֡Pp0@O 0@ Db FbG Db Db"P= @ "M`d&P  D"$ DW~ WfWdWbW`z({~` TP P`TW~W`z{~b`  @ k @`bT @ T0 P @W~" WbW`z {~db` R   @bH@k``bP$@W~WdWb W`z {~b` Te T @ T0 P @W~" WbW`z {~b`  @ k @`bT @ T0 P @T TW~" WbW`z {~` TQW8 W~W`z8 @P  {~` 8 @P  evTdzT *W~W`z8 @P   8 fG<4fG<֡Qp֡Qn{\{4fG<{p֡Q~֡Q~{H{~ 8 1-4FW~z{~ 8 1.S4OW~zQ 0QQP[UD`8 D#$  0 b X0XPZ֡Q    {~ fdb`  "@TD, 0 TNTD$  PT T Q0 @D Q`DP  8  @"PQ&`$p֡QW~ W~ WfWdWbW`z({~$h fdb`  Q(Q&$T&@(P"` p0$   bE$ W~$Wh WfWdWbW`z({~Dd@b<`8bە "@GFE LDA@5{00P֡Rs  P֡Rs  P֡Rs  P֡Rs  P֡Rs  P֡Rs  P֡Rs  P֡Rs  P֡Rs  P֡Rs  P֡Rs  P֡Rs  P֡Rs  P֡Rs  P֡Rs  P PdzTbDFLDAR$@W~DWd@Wb<W`8zH8 {~db`   @ k @`bTe P"`" W~WdWbW`z {~`<D h81, 5R @ W~W`z {~` k h  \k  W~W`z{~ 8 1.S5(9W~z{~b`p  S @j"P P֡RW~S7"PW~WbW`z {~b`  i \ 6"@j  Pj"P PW~WbW`z {@~db` dD \H!bP P"@SJ `"@$PT~L p@R"@$PW~WdWbW`z{~\dXbT`P dD@2 H\iJ S"@` D  D\L @TJ ,`bLPdD@\N @TJ D0b\DF` bDPTJJFP\LTJ @@b\H@,`bLP"@S$P P֡S"@ 8"@\`S\LJ`dN  H P D` P@0  D`LdDdF\NTJ D0b\DF`